DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34117 and FMC1

DIOPT Version :10

Sequence 1:NP_001036690.1 Gene:CG34117 / 4379851 FlyBaseID:FBgn0083953 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_932068.2 Gene:FMC1 / 154791 HGNCID:26946 Length:113 Species:Homo sapiens


Alignment Length:95 Identity:39/95 - (41%)
Similarity:60/95 - (63%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RSLLHELR--QASPNGCIKDSLAARYILAQYKKFATTEQQFCKARNEATFLGQTYLTYLASQRRY 70
            |.||.|||  .|:.....:|:.|.||::..::....|.::.|:|::|..|...|||..|.|.|::
Human    12 RGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLLRSIRKH 76

  Fly    71 LELYKEYHGRGERSVRDTADLVGFKLPSDP 100
            :.|::|:||:|||||.::|.|||.|||..|
Human    77 VALHQEFHGKGERSVEESAGLVGLKLPHQP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34117NP_001036690.1 Complex1_LYR_FMC1 3..97 CDD:380766 36/90 (40%)
FMC1NP_932068.2 Complex1_LYR_FMC1 7..103 CDD:380766 36/90 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..113 8/13 (62%)

Return to query results.
Submit another query.