DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34117 and si:ch1073-314i13.4

DIOPT Version :9

Sequence 1:NP_001036690.1 Gene:CG34117 / 4379851 FlyBaseID:FBgn0083953 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001373401.1 Gene:si:ch1073-314i13.4 / 100330660 ZFINID:ZDB-GENE-120214-41 Length:110 Species:Danio rerio


Alignment Length:96 Identity:34/96 - (35%)
Similarity:55/96 - (57%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVLRSLLHELRQASPNGCIKDSLAARYILAQYKKFATTEQQFCKARNEATFLGQTYLTYLASQRR 69
            :|.|.:|.|:|.|..:| .:.|...:|:|.|::|...|..|.|:|:.|:.....:|...|||.|.
Zfish     9 RVCRGILKEIRSAKGSG-YRHSPVYQYVLQQFRKNQVTGAQLCRAQMESLHAAVSYRCLLASTRL 72

  Fly    70 YLELYKEYHGRGERSVRDTADLVGFKLPSDP 100
            :..|:.:||.|||.:.:..|.|||.::|:.|
Zfish    73 HQRLHLQYHARGEHTPQQAAALVGLRMPNQP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34117NP_001036690.1 Complex1_LYR_2 8..95 CDD:289975 31/86 (36%)
si:ch1073-314i13.4NP_001373401.1 Complex1_LYR_SF 7..100 CDD:394799 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590664
Domainoid 1 1.000 58 1.000 Domainoid score I10797
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5354
OMA 1 1.010 - - QHG50159
OrthoDB 1 1.010 - - D1630277at2759
OrthoFinder 1 1.000 - - FOG0008307
OrthoInspector 1 1.000 - - oto41168
orthoMCL 1 0.900 - - OOG6_110928
Panther 1 1.100 - - LDO PTHR31716
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2872
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.