DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stnB and TOA1

DIOPT Version :9

Sequence 1:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_014837.1 Gene:TOA1 / 854369 SGDID:S000005720 Length:286 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:43/176 - (24%)
Similarity:71/176 - (40%) Gaps:38/176 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 SNEISSRDEPVFTSLLIRPD-ESTHDI--TSQPQAATGLERQVNNMAA-----PSGTASTQRATT 402
            |:|.:.::|......||.|: .|.::|  :.:....|......||..|     .||..:....:.
Yeast    83 SSEFNIKEENTGNEGLILPNINSNNNIPHSGETNINTNTVEATNNSGATLNTNTSGNTNADVTSQ 147

  Fly   403 PDIE-------------ITTVEDLPRSDDEDEPEAMQEPETETKPQIEPDTEPEIVSEHSPPTER 454
            |.||             |||||::   |||.|.:..:|.|.:.:...:...:.|.|...:...:|
Yeast   148 PKIEVKPEIELTINNANITTVENI---DDESEKKDDEEKEEDVEKTRKEKEQIEQVKLQAKKEKR 209

  Fly   455 LVTQAALVDGELIAAEPEPEEMDTGLDFPLASSGQLSANPFASPDE 500
                :||:|.:.:.:     |:|...|..|.|.|:..     .|||
Yeast   210 ----SALLDTDEVGS-----ELDDSDDDYLISEGEED-----GPDE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603 32/136 (24%)
AP_MHD_Cterm 897..1219 CDD:299401
TOA1NP_014837.1 TFIIA_alpha_beta_like 1..286 CDD:354906 43/176 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.