DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stnB and AT5G46630

DIOPT Version :9

Sequence 1:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_974895.1 Gene:AT5G46630 / 834706 AraportID:AT5G46630 Length:441 Species:Arabidopsis thaliana


Alignment Length:368 Identity:80/368 - (21%)
Similarity:150/368 - (40%) Gaps:60/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   834 FAQYAIAGDYEGVKEFGSDLKKLGLPVEHAPQSSQLF--KIGSMNYEDMKQFSVCIEEALFKIPA 896
            |.:.||..::..:.|...::...|.|...:|:..:|:  :.|..:....|.....:..|..::..
plant   100 FDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKPKDKPVPNATLQVTG 164

  Fly   897 L---RERALTYKMEEVQVTAVDEITVEQDFEGKILKQIARVRLFFLAFLTGMPTIELGVNDMWRQ 958
            .   |...|.||..||.:..|:.:.:....:|.:|:.....::....||:|||.::||:||  :.
plant   165 AVGWRREGLAYKKNEVFLDIVESVNLLMSSKGNVLRCDVTGKVLMKCFLSGMPDLKLGLND--KI 227

  Fly   959 GKEVVGRHDIIPVATEEWIRLEAVEFHSVVNQKEYERTRTIKFQPPDANYIELLRFRVRPPKNRE 1023
            |.|........|..:.:.|.|:.|.||..||...:...:|:.|.|||..: ||:::|:....|  
plant   228 GLEKESEMKSRPAKSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEF-ELMKYRITEGVN-- 289

  Fly  1024 LPLQLKATWCVSGNKVELRADILVPGFTSRKLGQIPCEDVSVRFPIPECWIYLFRVEKHFRYGSV 1088
            ||.::..|....| :..:..::.|......|:..:   .|.|:.|:|                  
plant   290 LPFRVLPTIKELG-RTRMEVNVKVKSVFGAKMFAL---GVVVKIPVP------------------ 332

  Fly  1089 KSAHRRTGKIKGIERILGAVDTLQESLIEVTSGQAKYEHHHRAIVWRCPRLPKEGQGAYTTH-QL 1152
                ::|.|..                .:||:|:|||......:||:..:.|.:.:...:.. :|
plant   333 ----KQTAKTN----------------FQVTTGRAKYNPSIDCLVWKIRKFPGQTESTLSAEIEL 377

  Fly  1153 VCRMA-LTSYDQIPSELAPYAFVEFTMPATQVSHTTVRSVSVQ 1194
            :..|. ..|:.:.|.::      ||.:|....|...||.:.|:
plant   378 ISTMGEKKSWTRPPIQM------EFQVPMFTASGLRVRFLKVR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 69/303 (23%)
AT5G46630NP_974895.1 AP-2_Mu2_Cterm 175..413 CDD:271159 66/290 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10529
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.