DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stnB and gtf2a1l

DIOPT Version :9

Sequence 1:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_001070039.1 Gene:gtf2a1l / 767629 ZFINID:ZDB-GENE-060929-28 Length:376 Species:Danio rerio


Alignment Length:366 Identity:80/366 - (21%)
Similarity:114/366 - (31%) Gaps:121/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DETSSELLGRIPATRSPSPVSMRDLHSPSP-----------TPDSGLADLLDVSVDSGSSAHTQ- 192
            |...|:.:.::||..:.|      ||.|:.           |..:....:...|:..|.:...| 
Zfish    60 DNNPSKFVLQLPANYTQS------LHKPTVVIPAAANVQNFTSKTSCGSVATFSLPPGITYPVQI 118

  Fly   193 --GIEADLISG----------VAGGVR--LDNPFAVPTAVPNIQAAVPLPATPIKQPPRPPPPRP 243
              |:.....||          |..|.:  |..|...|..:|.:.|.:|.||.|...|....|  .
Zfish   119 PAGVTLQTASGHLYKVNVPVMVTRGAQHVLTRPAQAPVTLPQLPARLPDPAAPAYLPNSTAP--A 181

  Fly   244 APPRPAPPGQAAPQRPPPPLAAVNPPPAAPEADDLLDMFGTTACKPAKPPPPKSKEDILSLFEQP 308
            .||.||||   |.|.||.|.:|     :|...:..||..      ...|.|..:..         
Zfish   182 CPPDPAPP---ALQTPPEPSSA-----SASPGEFTLDGI------EFSPQPVDASS--------- 223

  Fly   309 HVPLSQPASKPDLLHDDLDETIGEGEPPEQEEPD-TEQSNEISSRDEPVFTSLLIRPDESTHDIT 372
            |.|.               :..|....|::.:.| .:..|..|...:..|:.||        || 
Zfish   224 HTPA---------------QHCGYSSFPKERDADPPDLQNNTSPGQQLSFSPLL--------DI- 264

  Fly   373 SQPQAATGLERQVNNMAAPSGTASTQRATTPDIEITTVEDLPRSDDEDEPEAMQEPETETKPQIE 437
              ||.              .|.|.:             .|....:||||.|.....|.|....|.
Zfish   265 --PQL--------------DGAADS-------------SDSLEEEDEDEEELGLVGEKEFLGMIS 300

  Fly   438 PDTEPEIVSEHSPPTERLVTQAALVDGELIAAEPEPEEMDT 478
            .:.|.|:..|..|          |..|:.::.:..||..||
Zfish   301 ANEEEELEEEEDP----------LNSGDDVSEQDIPEIFDT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603 21/102 (21%)
AP_MHD_Cterm 897..1219 CDD:299401
gtf2a1lNP_001070039.1 TFIIA_alpha_beta_like 8..>68 CDD:199899 2/7 (29%)
TFIIA 11..376 CDD:281188 80/366 (22%)
TFIIA_alpha_beta_like <319..376 CDD:199899 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 1 1.000 - - X2217
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.