DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stnB and TfIIA-L

DIOPT Version :9

Sequence 1:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_476995.1 Gene:TfIIA-L / 43284 FlyBaseID:FBgn0011289 Length:366 Species:Drosophila melanogaster


Alignment Length:377 Identity:73/377 - (19%)
Similarity:121/377 - (32%) Gaps:132/377 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PPPLAAVNPPPAAPEADDLLDMFGTTACKPAKPPPPKSKEDILSLFEQPHVPLSQPASKPDL--L 322
            |||:.|.||                   |..|....|:|:...:.....|..:...:|...|  |
  Fly    66 PPPIVANNP-------------------KSHKAANAKAKKAAAATAVTSHQHIGGNSSMSSLVGL 111

  Fly   323 HDDLDETIGEG-----EPPEQEEPDTEQSNEISSRDEPVFTSLLIRPDESTHDITSQPQAATGLE 382
            ........|.|     .|.:|         |::|::.|.     :.|..:...:..|.|||:..:
  Fly   112 KSSAGMAAGSGIRNGLVPIKQ---------EVNSQNPPP-----LHPTSAASMMQKQQQAASSGQ 162

  Fly   383 RQVNNMA---------------APSGTASTQRATTPDIEITTVEDLPRSDDEDEPEAMQEPETET 432
            ..:..:|               :|:|:||::.      .:.|:: :|.|       |:||.:.  
  Fly   163 GSIPIVATLDPNRIMPVNITLPSPAGSASSES------RVLTIQ-VPAS-------ALQENQL-- 211

  Fly   433 KPQIEPDTEPEIVSEH------SPPT--------------------ERLVTQAALVDGELIAA-E 470
                     .:|::.|      |.||                    ::.:..|..:||.|.:: |
  Fly   212 ---------TQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLAAAKQLDGALDSSDE 267

  Fly   471 PEPEEMDTGLDFPLASSGQLSANPFASPD-----EEEPNFAPMPAAVANIFAVNDPDSQMETPKA 530
            .|.||.|..:|..  ....|..:.....:     ||||              :|..|...:...|
  Fly   268 DESEESDDNIDND--DDDDLDKDDDEDAEHEDAAEEEP--------------LNSEDDVTDEDSA 316

  Fly   531 PS-HTANIFASDPDEFDAFSAKFDSVKKDNISIMDGFGGSGAITPTGGDA-W 580
            .. .|.|:.....|:......|:....||  .||:..|.......:.||| |
  Fly   317 EMFDTDNVIVCQYDKITRSRNKWKFYLKD--GIMNMRGKDYVFQKSNGDAEW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603 29/160 (18%)
AP_MHD_Cterm 897..1219 CDD:299401
TfIIA-LNP_476995.1 TFIIA_alpha_beta_like 8..>62 CDD:199899
TFIIA 11..366 CDD:281188 72/375 (19%)
TFIIA_alpha_beta_like <306..366 CDD:199899 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.