DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stnB and GTF2A1

DIOPT Version :9

Sequence 1:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_056943.1 Gene:GTF2A1 / 2957 HGNCID:4646 Length:376 Species:Homo sapiens


Alignment Length:267 Identity:63/267 - (23%)
Similarity:98/267 - (36%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 QSQPQLQSHAHPH---PPPPRPLVPPQS-TQDLISTVSSQLDE-----TSSELLGRIPATRSPSP 158
            |.|||.|.|.|.|   ...|:..||.|: ||.::...|.|...     ..|:|:..:.|:...:.
Human    73 QHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAA 137

  Fly   159 VSMRDLHSPSPTPDSGLADLLDVSVDSGSSAHTQGIEADLISGVAGGVRLDNPFAVPTAVPNIQA 223
            .:...|..|     :|:..:..:..:||..       ..::....|...:..|          |.
Human   138 ATAATLALP-----AGVTPVQQILTNSGQL-------LQVVRAANGAQYIFQP----------QQ 180

  Fly   224 AVPLPATPIKQPPRPPPPRPAPPRP---AP-PGQAAPQ-----RPPPPLAAVNPPPAAPEADDLL 279
            :|.|....|  |...|....||...   || ||..:||     :|...|...|.....|      
Human   181 SVVLQQQVI--PQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIP------ 237

  Fly   280 DMFGTTACKPAKPPPPKSKEDILSLFEQPHVPLSQPA--SKPDLLH-DDLDETIGEGEPPEQEEP 341
                ||.   |.|.|.:::  |.:..:|.  |.:|||  ..|.:|. |...:|..|.:..|:|:.
Human   238 ----TTV---AAPTPAQAQ--ITATGQQQ--PQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDY 291

  Fly   342 DTEQSNE 348
            |.::..:
Human   292 DDDEEED 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401
GTF2A1NP_056943.1 TFIIA 13..376 CDD:397322 63/267 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..107 14/33 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..266 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..329 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.