DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxA and RUNX1

DIOPT Version :9

Sequence 1:NP_001259747.1 Gene:RunxA / 4379817 FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001745.2 Gene:RUNX1 / 861 HGNCID:10471 Length:480 Species:Homo sapiens


Alignment Length:479 Identity:173/479 - (36%)
Similarity:223/479 - (46%) Gaps:118/479 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GNNNNSSGNNSNTEQN-TPPTPA---QLLNEAYTKMTSDILA---------ERTLGDFLTEHPGE 98
            |.|.:...::::|.:. |||:.|   ..::||......|..|         :|::.:.|.:||||
Human    24 GMNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGE 88

  Fly    99 LIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENYCAELRNCTAVMKN 163
            |:||.||.|:|:|||.|||.|||||:|||||:|||:.|||:|||.|||||||.|||||.||.|||
Human    89 LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKN 153

  Fly   164 QVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRSKTMLSLLGQQQQF 228
            |||:||||||||||||||||||||||.||||.:|||::|||:||||||||| :....|..|.:..
Human   154 QVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR-RHRQKLDDQTKPG 217

  Fly   229 HFAFGQR---------------PFHFSTDP--------LSGFRMPPIGNCQSASNTH----WGYG 266
            ..:|.:|               |.|.:..|        .:.|...|....|......    |.|.
Human   218 SLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYD 282

  Fly   267 SAASAYSPYLASSGLSSC--TTPTSAQFNNPALGFTCSSNDQSNNQDFGGATNRDCVPMLPDSTA 329
            .:..    ||.|....|.  .||.|.   ..|.|.|..|.:.|:..                |||
Human   283 QSYQ----YLGSIASPSVHPATPISP---GRASGMTTLSAELSSRL----------------STA 324

  Fly   330 SDL----DQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVN-GASGGGSA------------GAG 377
            .||    |......:.|.|....|:........|.::|.:. |.|..|||            |:.
Human   325 PDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSS 389

  Fly   378 TAGGGA------------GSGGGA------GGGAGGNSILVPRYHTNAS-----------NEYNV 413
            .|.||.            |:..|:      ||......||.|  .||||           |:.:|
Human   390 QAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPP--CTNASTGSALLNPSLPNQSDV 452

  Fly   414 ----HSSQNGPRSLSDSSQAESPV 433
                .|..|.|.:::.|::.|..|
Human   453 VEAEGSHSNSPTNMAPSARLEEAV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/120 (81%)
RUNX1NP_001745.2 Runt 81..207 CDD:395684 98/126 (78%)
RunxI 389..480 CDD:400691 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2778
eggNOG 1 0.900 - - E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8468
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.