DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxA and rnt-1

DIOPT Version :9

Sequence 1:NP_001259747.1 Gene:RunxA / 4379817 FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001370335.1 Gene:rnt-1 / 172243 WormBaseID:WBGene00004393 Length:301 Species:Caenorhabditis elegans


Alignment Length:295 Identity:98/295 - (33%)
Similarity:136/295 - (46%) Gaps:44/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DFLTEHPG---ELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENYC 151
            :|:.:.|.   .|.::|||..:.|.||.||||||:....|.||.|..:.|.|.|::.|||||..|
 Worm    10 NFIEQQPAPAKTLEKSSSPNILYTALPKHWRSNKSFQEPFYVVLLTPVPDNTEVSIWAGNDEKPC 74

  Fly   152 AELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPR-S 215
            .|:||..|.:..|||||||||||||||||:.|.|||.:.:.|..:||....|||||||||:.| .
 Worm    75 EEVRNEKAKVHRQVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVATVKNVIKVTVDGPRDARIP 139

  Fly   216 KTMLSLLGQQQQ-------------------------FHFAFGQRPFHFSTDPLSGFRMPPIGNC 255
            |...||..|.:|                         |.....|      |.|.|.|.:...|..
 Worm   140 KPQGSLKRQAEQQTIFPNDIIRTPGPPMPMTMIPPPWFPLPMTQ------TFPPSFFPLISPGPH 198

  Fly   256 QSASNTHWGYGSAASAYSPYLASSGLSSCTTPTSAQFNNPALGFTCSSNDQSNNQDF-------G 313
            .|.|...|...| .|..:|........:.:..||...::|::..|.:|:|:...:..       .
 Worm   199 PSISAALWKIHS-ESMKTPIKQKVEQENVSLNTSTCLSSPSIFITPTSDDRKLKRPSSPRSITKS 262

  Fly   314 GATNRDCVPMLPDSTASDLDQHLSSLVGSTSGQMT 348
            ..|:.:.:...|:|..|...::: |:..|.|...|
 Worm   263 SETSINLIQETPESVESKRRRNV-SITSSNSSSPT 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 65/124 (52%)
rnt-1NP_001370335.1 Runt 22..137 CDD:395684 63/114 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - otm14562
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.870

Return to query results.
Submit another query.