DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-49 and ndhH

DIOPT Version :9

Sequence 1:NP_001259064.1 Gene:ND-49 / 43798 FlyBaseID:FBgn0039909 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_051115.1 Gene:ndhH / 844805 -ID:- Length:393 Species:Arabidopsis thaliana


Alignment Length:386 Identity:153/386 - (39%)
Similarity:236/386 - (61%) Gaps:5/386 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSM 149
            :.:|.||.||:.||||||::.||||.|:..:|.:|.||||.||:.|.:...|.|||..|.||::.
plant    11 MIVNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLAT 75

  Fly   150 MCNEQCYSLAVEKLLNIDVPLRAKYIRTLFAEITRILNHIMAVGTHALDVGALTPFFWLFEEREK 214
            |..|.......|:|.||.||.||.|||.:..|::||.:|::.:|....|:||.||||::|.|||.
plant    76 MFTEAITVNGPEQLGNIQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYIFREREF 140

  Fly   215 MMEFYERVSGARMHAAYIRPGGVSLDMPLGLMDDIYEFASKFAERLDEVEDVLTTNRIWVQRTED 279
            :.:.:|..:|.||...:.|.||::.|:|.|.:|...:|...|...:.|.:.::|.|.|:::|.|.
plant   141 VYDLFEAATGMRMMHNFFRIGGIAADLPYGWIDKCLDFCDYFLTEVVEYQKLITRNPIFLERVEG 205

  Fly   280 IGIVTAEEALNYGFSGVMLRGSGIKWDLRKQQPYDAYNLVNFDVPIGTKGDCYDRYLCRVEEMRQ 344
            :||:..|||:|:|.||.|||.|||.|||||...|::|:...:::....:||...|||.|:.||.:
plant   206 VGIIGGEEAINWGLSGPMLRASGIPWDLRKIDRYESYDEFEWEIQWQKQGDSLARYLVRLSEMTE 270

  Fly   345 SLRIIDQCLNQMPAGEIKTDDAKVAPPSRSEMKTSMEALIHHF--KLFTQGYQVPPGATYTAIEA 407
            |::||.|.|..:|.|..:..:::.....|:......|   :.|  |..:..:::.....|..:||
plant   271 SIKIIQQALEGLPGGPYENLESRGFDRKRNPEWNDFE---YRFISKKPSPTFELSKQELYVRVEA 332

  Fly   408 PKGEFGVYLISDGSSRPYRCKIKAPGFAHLAALEKIGKQHMLADVVAIIGTLDVVFGEIDR 468
            ||||.|::||.|.|..|:|.||:.|||.:|..|.::.|:..|||::.|:|::|::.||:||
plant   333 PKGELGIFLIGDQSGFPWRWKIRPPGFINLQILPELVKRMKLADIMTILGSIDIIMGEVDR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-49NP_001259064.1 PRK06075 79..468 CDD:180385 151/384 (39%)
NuoD 79..468 CDD:223722 151/384 (39%)
ndhHNP_051115.1 ndhH 1..393 CDD:176960 151/384 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60638
OrthoDB 1 1.010 - - D444312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101051
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.