DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and PUR ALPHA-1

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_565736.1 Gene:PUR ALPHA-1 / 817768 AraportID:AT2G32080 Length:296 Species:Arabidopsis thaliana


Alignment Length:278 Identity:86/278 - (30%)
Similarity:132/278 - (47%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GGSGVEQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSF 100
            ||.|.:.||.:|.||::.|.||.|:|:|.|||::|::| .....||.|.:..|..:.|.|    .
plant    23 GGGGSDVELVSKTLQVEHKLFYFDLKENPRGRYLKISE-KTSATRSTIIVPSSGISWFLD----L 82

  Fly   101 SDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQ-TITRGGPRSQIALP 164
            .:||.:         .|:.:|.|:.:..|.:.:|.|:.||.|||||:||: :::|.  ||.|.:|
plant    83 FNYYVN---------SEEHELFSKELQLDSKVFYFDIGENRRGRFLKVSEASVSRN--RSTIIVP 136

  Fly   165 A-----QGMIEFRDALTDLLEEFG---------ANDG----------GRFKG------------- 192
            |     :|...||:.|.::.|..|         .:||          |...|             
plant   137 AGSSPDEGWAAFRNILAEIHEASGLFVMPNQVKPSDGQEHLVDDVGAGFIPGHGSQQPSSSEHNV 201

  Fly   193 ----DLP--EERHM-------KVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR 244
                |.|  ||..|       :.|.|.|:||:|.||||.::|||||..:.|:||.:|.....:|.
plant   202 DRTIDSPGQEETGMTGVSKVIRADQKRFFFDLGNNNRGHFLRISEVAGSDRSSIILPLSGLKQFH 266

  Fly   245 DIFNDYCEKMKKSSDSIT 262
            ::...:.|..|...:.:|
plant   267 EVIGHFVEITKDKIEGMT 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 81/263 (31%)
PUR ALPHA-1NP_565736.1 PurA 30..274 CDD:282672 80/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I3421
eggNOG 1 0.900 - - E1_KOG3074
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134801
Inparanoid 1 1.050 102 1.000 Inparanoid score I2164
OMA 1 1.010 - - QHG59777
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - oto3915
orthoMCL 1 0.900 - - OOG6_106010
Panther 1 1.100 - - LDO PTHR12611
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X718
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.