DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and purg

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_009301484.1 Gene:purg / 569414 ZFINID:ZDB-GENE-070702-3 Length:323 Species:Danio rerio


Alignment Length:271 Identity:112/271 - (41%)
Similarity:153/271 - (56%) Gaps:57/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGA------DGRRSQIYLALSTAAEFRDHLSSF 100
            ||||:|.:.||.|||||||||:.||||:|:||:..      :.|:|::.|::|.|.:.|..|..|
Zfish    35 QELASKRVDIQKKRFYLDVKQSTRGRFLKIAEVWIGRGRHDNIRKSKLTLSMSMAPDLRYCLGDF 99

  Fly   101 SDYYASLG--------------------------------PPNTDNLPEDGK---LKSEMMIKDY 130
            .||||.:|                                .||.....|:..   ||||.:.:|.
Zfish   100 IDYYAHIGLRGCQAAERRPEEQSNGQGRAPDPRRRAEQAASPNGSGASEEQTHRVLKSEFIERDN 164

  Fly   131 RRYYLDLKENARGRFLRVSQTITRG---------GPRSQIALPAQGMIEFRDALTDLLEEFGAND 186
            |:||||||||.||||||:.||:|||         |....|.|||||:|||||||:.|::::|.::
Zfish   165 RKYYLDLKENQRGRFLRIRQTVTRGHGSMGYYGQGIEQTIVLPAQGLIEFRDALSQLIDDYGDDE 229

  Fly   187 GGRF-------KGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR 244
            ..|.       ..:|||....:||||.||||:|.|..||:::||||:..:|.:||:|.|.|.||.
Zfish   230 PERACARNHDESPELPEAASFRVDNKRFYFDVGSNRFGVFLKISEVRQPYRNTITVPLKAWARFG 294

  Fly   245 DIFNDYCEKMK 255
            :.|..|.|:|:
Zfish   295 ENFMRYEEEMR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 111/268 (41%)
purgXP_009301484.1 PurA 34..304 CDD:282672 111/268 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581869
Domainoid 1 1.000 231 1.000 Domainoid score I2363
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I3330
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - otm25439
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12611
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X718
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.