DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and purba

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001153631.1 Gene:purba / 565233 ZFINID:ZDB-GENE-060531-100 Length:317 Species:Danio rerio


Alignment Length:291 Identity:136/291 - (46%)
Similarity:179/291 - (61%) Gaps:48/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DGISGSKYNVANMEGSSSRNDFDSSAKGGSG------------VEQELATKMLQIQSKRFYLDVK 61
            ||.|||:..     |||.......|..||.|            ..||||:|.|.||:||||||||
Zfish     6 DGDSGSERG-----GSSGGGGGGGSGGGGGGGGSGFQPFQRDQETQELASKRLDIQNKRFYLDVK 65

  Fly    62 QNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLP-----EDG-- 119
            ||.:|||||:||:||.|.:|::.|::|.||||||:|..|.::||.|||...:.:.     |||  
Zfish    66 QNSKGRFIKIAEVGAGGSKSRLTLSMSVAAEFRDYLGDFIEHYAQLGPSTPEQIAQSSGGEDGGP 130

  Fly   120 --KLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITR-------------GGPRS--QIALPAQG 167
              .||||.::::.|:||||||||.||||||:.||:.|             ||.:|  .|||||||
Zfish   131 RRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGPGGFGAGGGVPGGGMQSGQTIALPAQG 195

  Fly   168 MIEFRDALTDLLEEFGAND----GGRFK---GDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEV 225
            :|||||||..|::::|.:|    ||...   |:|||...:.||:|.|:||:|.|..||::|:|||
Zfish   196 LIEFRDALAKLIDDYGGDDEELVGGGCSGAYGELPEGTSITVDSKRFFFDVGSNKYGVFLRVSEV 260

  Fly   226 KNNFRTSITIPEKCWIRFRDIFNDYCEKMKK 256
            |.::|.|||||.|.|.:|...|..|.|:||:
Zfish   261 KPSYRNSITIPFKAWSKFGGAFCRYAEEMKE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 122/243 (50%)
purbaNP_001153631.1 PurA 45..289 CDD:282672 122/243 (50%)
PUR 47..109 CDD:197840 38/61 (62%)
PUR 134..211 CDD:197840 40/76 (53%)
PUR 229..290 CDD:197840 30/60 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581866
Domainoid 1 1.000 231 1.000 Domainoid score I2363
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I3330
OMA 1 1.010 - - QHG59777
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - otm25439
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12611
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X718
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.