DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and purab

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_005157218.1 Gene:purab / 557266 ZFINID:ZDB-GENE-141216-78 Length:279 Species:Danio rerio


Alignment Length:265 Identity:123/265 - (46%)
Similarity:174/265 - (65%) Gaps:21/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDLGSGDD--GISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDVKQN 63
            |:|..||.:  |.:..........|::||...|:         :|||:|.:.||:||||||||||
Zfish     1 MADRDSGSEHGGFATGPGAGPMHPGAASRLQHDT---------EELASKRVDIQNKRFYLDVKQN 56

  Fly    64 RRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGK--LKSEMM 126
            .:|||:|:||:||.|.:|::.|::|.|.||||:|..|.::||.|||.|.|.:.::.:  ||||.:
Zfish    57 AKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSNPDLVQDEPRRALKSEFL 121

  Fly   127 IKDYRRYYLDLKENARGRFLRVSQTITRG-----GPRSQIALPAQGMIEFRDALTDLLEEFGAND 186
            :::.|:||:|||||.||||||:.||:.||     .....|||||||:|||||||..|:::||.::
Zfish   122 VRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGTSQGQTIALPAQGLIEFRDALAKLIDDFGVDE 186

  Fly   187 GGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYC 251
            .   ..:|||...:.||||.|:||:|.|..||:||:||||..:|.|||:|.|.|.:|...|..|.
Zfish   187 D---PAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPCKVWSKFGATFCKYA 248

  Fly   252 EKMKK 256
            ::|||
Zfish   249 DEMKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 111/219 (51%)
purabXP_005157218.1 PurA 34..251 CDD:282672 111/228 (49%)
PUR 36..98 CDD:197840 35/61 (57%)
PUR 116..183 CDD:197840 37/66 (56%)
PUR 191..252 CDD:197840 30/60 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581867
Domainoid 1 1.000 231 1.000 Domainoid score I2363
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134801
Inparanoid 1 1.050 238 1.000 Inparanoid score I3330
OMA 1 1.010 - - QHG59777
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - otm25439
orthoMCL 1 0.900 - - OOG6_106010
Panther 1 1.100 - - O PTHR12611
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X718
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.