DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and Purb

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001017503.2 Gene:Purb / 498407 RGDID:1559465 Length:317 Species:Rattus norvegicus


Alignment Length:288 Identity:128/288 - (44%)
Similarity:176/288 - (61%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DGISGSKYNVANMEGSSSRNDFDSSAKGGSG-----VEQELATKMLQIQSKRFYLDVKQNRRGRF 68
            ||.|||:..    .|......|..:.:||.|     ..||||:|.|.||:||||||||||.:|||
  Rat     3 DGDSGSERG----GGGGGPGSFQPAPRGGGGPGGEQETQELASKRLDIQNKRFYLDVKQNAKGRF 63

  Fly    69 IKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNL---PEDG-----KLKSEM 125
            :|:||:||.|.:|::.|:::.||||||.|..|.::||.|||.:.:.|   .|:|     .||||.
  Rat    64 LKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEF 128

  Fly   126 MIKDYRRYYLDLKENARGRFLRVSQTITRGG-------------PRSQIALPAQGMIEFRDALTD 177
            ::::.|:||||||||.||||||:.||:.|||             ....|||||||:|||||||..
  Rat   129 LVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRDALAK 193

  Fly   178 LLEEFGAND--------------GGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNN 228
            |::::|..|              ||...|:|||...:.||:|.|:||:|.|..||::|:||||.:
  Rat   194 LIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPS 258

  Fly   229 FRTSITIPEKCWIRFRDIFNDYCEKMKK 256
            :|.:||:|.|.|.:|...|..|.::||:
  Rat   259 YRNAITVPFKAWGKFGGAFCRYADEMKE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 116/247 (47%)
PurbNP_001017503.2 PurA 36..284 CDD:282672 116/247 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..222 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341841
Domainoid 1 1.000 222 1.000 Domainoid score I2502
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 231 1.000 Inparanoid score I3358
OMA 1 1.010 - - QHG59777
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - otm45056
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12611
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X718
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.