DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and purbb

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_956841.1 Gene:purbb / 393519 ZFINID:ZDB-GENE-040426-1478 Length:297 Species:Danio rerio


Alignment Length:273 Identity:131/273 - (47%)
Similarity:177/273 - (64%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DFDS-SAKGGS--GVE--------QELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQ 82
            |.|| |.:|||  |::        ||||:|.|.||:||||||||||.:|||||:||:||.|.:|:
Zfish     3 DGDSGSERGGSSGGLQHFQREQETQELASKRLDIQNKRFYLDVKQNAKGRFIKIAEVGAGGSKSR 67

  Fly    83 IYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLP-----EDG----KLKSEMMIKDYRRYYLDLK 138
            :.|::|.||||||:|..|.::||.|||.:.:.:.     :||    .||||.::::.|:||||||
Zfish    68 LTLSMSVAAEFRDYLGDFIEHYAQLGPSSPEQIAQSSGGDDGGPRRALKSEFLVRENRKYYLDLK 132

  Fly   139 ENARGRFLRVSQTITR---------GGP------RSQIALPAQGMIEFRDALTDLLEEFGAND-- 186
            ||.||||||:.||:.|         |||      ...|||||||:|||||||..|::::|..|  
Zfish   133 ENQRGRFLRIRQTVNRGPGFGVGGGGGPGGGVQAGQTIALPAQGLIEFRDALAKLIDDYGGEDEE 197

  Fly   187 --------GGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRF 243
                    ||  .|:|||...:.||:|.|:||:|.|..||::|:||||.::|.|||||.|.|.:|
Zfish   198 LSGGPGAAGG--YGELPEGTSIMVDSKRFFFDVGSNKYGVFLRVSEVKPSYRNSITIPFKAWGKF 260

  Fly   244 RDIFNDYCEKMKK 256
            ...|:.|.|:||:
Zfish   261 GGAFSRYAEEMKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 121/254 (48%)
purbbNP_956841.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 8/22 (36%)
PurA 26..271 CDD:282672 121/246 (49%)
PUR 28..90 CDD:197840 38/61 (62%)
PUR 115..192 CDD:197840 40/76 (53%)
PUR 211..272 CDD:197840 30/60 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..297
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581870
Domainoid 1 1.000 231 1.000 Domainoid score I2363
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I3330
OMA 1 1.010 - - QHG59777
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - otm25439
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12611
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4144
SonicParanoid 1 1.000 - - X718
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.040

Return to query results.
Submit another query.