DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and PURG

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001310240.1 Gene:PURG / 29942 HGNCID:17930 Length:347 Species:Homo sapiens


Alignment Length:315 Identity:122/315 - (38%)
Similarity:172/315 - (54%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GSGDDGISGSKYNVANMEGSSSRNDFDSSA-------KGGSGVEQELATKMLQIQSKRFYLDVKQ 62
            |.|...:.||..:.:.:...:..:.:...|       .||:...||||:|.:.||.|||||||||
Human    14 GRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKKRFYLDVKQ 78

  Fly    63 NRRGRFIKVAEI----GADG--RRSQIYLALSTAAEFRDHLSSFSDYYASLG------------- 108
            :.||||:|:||:    |...  |:|::.|:||.|||.:|.|..|.::||.||             
Human    79 SSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKE 143

  Fly   109 -------------PP---NTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRG-- 155
                         ||   .::..|. ..||::.:.:|.|:||||||||.||||||:.||:.||  
Human   144 QGSRRRQKHSAPSPPVSVGSEEHPH-SVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTG 207

  Fly   156 ---------GPRSQIALPAQGMIEFRDALTDLLEEFGANDGGRFKG------DLPEERHMKVDNK 205
                     |....|.|||||||||||||..|:|::|..|....:|      :|||....:||||
Human   208 MIGYFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNK 272

  Fly   206 NFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKMKKSSDS 260
            .||||:|.|..|:::::|||:..:|.:||:|.|.|.||.:.|..|.|:|:|..:|
Human   273 RFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 112/264 (42%)
PURGNP_001310240.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 4/19 (21%)
PurA 57..321 CDD:282672 112/264 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..169 3/36 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147974
Domainoid 1 1.000 224 1.000 Domainoid score I2567
eggNOG 1 0.900 - - E1_KOG3074
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 231 1.000 Inparanoid score I3440
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - otm40919
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12611
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X718
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.