DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pur-alpha and Purb

DIOPT Version :9

Sequence 1:NP_001259062.1 Gene:Pur-alpha / 43797 FlyBaseID:FBgn0022361 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_035351.1 Gene:Purb / 19291 MGIID:1338779 Length:324 Species:Mus musculus


Alignment Length:292 Identity:127/292 - (43%)
Similarity:177/292 - (60%) Gaps:45/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DGISGSKYNVANMEGSSSRNDFDSSAKGGSG---------VEQELATKMLQIQSKRFYLDVKQNR 64
            ||.|||:.. ....|......|..:.:||.|         ..||||:|.|.||:||||||||||.
Mouse     3 DGDSGSERG-GGGGGGGGPGGFQPAPRGGGGGGGGPGGEQETQELASKRLDIQNKRFYLDVKQNA 66

  Fly    65 RGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNL---PEDG-----KL 121
            :|||:|:||:||.|.:|::.|:::.||||||.|..|.::||.|||.:.:.|   .|:|     .|
Mouse    67 KGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRAL 131

  Fly   122 KSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGG-------------PRSQIALPAQGMIEFRD 173
            |||.::::.|:||||||||.||||||:.||:.|||             ....|||||||:|||||
Mouse   132 KSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRD 196

  Fly   174 ALTDLLEEFGAND--------------GGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISE 224
            ||..|::::|.::              ||...|:|||...:.||:|.|:||:|.|..||::|:||
Mouse   197 ALAKLIDDYGGDEDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSE 261

  Fly   225 VKNNFRTSITIPEKCWIRFRDIFNDYCEKMKK 256
            ||.::|.:||:|.|.|.:|...|..|.::||:
Mouse   262 VKPSYRNAITVPFKAWGKFGGAFCRYADEMKE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pur-alphaNP_001259062.1 PurA 41..254 CDD:282672 115/247 (47%)
PurbNP_035351.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 13/45 (29%)
PurA 43..291 CDD:282672 115/247 (47%)
PUR 45..107 CDD:197840 36/61 (59%)
PUR 131..206 CDD:197840 39/74 (53%)
PUR 231..292 CDD:197840 27/60 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838063
Domainoid 1 1.000 224 1.000 Domainoid score I2542
eggNOG 1 0.900 - - E1_KOG3074
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3444
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59777
OrthoDB 1 1.010 - - D1248813at2759
OrthoFinder 1 1.000 - - FOG0001061
OrthoInspector 1 1.000 - - otm42992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12611
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4144
SonicParanoid 1 1.000 - - X718
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.900

Return to query results.
Submit another query.