DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thd1 and TDG

DIOPT Version :9

Sequence 1:NP_001259060.1 Gene:Thd1 / 43796 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_003202.3 Gene:TDG / 6996 HGNCID:11700 Length:410 Species:Homo sapiens


Alignment Length:387 Identity:153/387 - (39%)
Similarity:214/387 - (55%) Gaps:75/387 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 INFKPMPKK---------------RGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQA 754
            :|.:.||::               :|||:|     ..|::...||:.:|      ..|.....::
Human    35 VNEQQMPEEVPAPAPAQEPVQEAPKGRKRK-----PRTTEPKQPVEPKK------PVESKKSGKS 88

  Fly   755 AKPKE-----------RKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYA 808
            ||.||           ::|.|||||:||.|::.:|:||.|..||||||:||||||.||||||||.
Human    89 AKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYP 153

  Fly   809 GPGNHFWKCLYLAGLTQEQMSADEDHKLI-KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEK 872
            ||||||||||:::||::.|::..:||.|. |.||||||||.|.|.||.||:.||.:||.|||::|
Human   154 GPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 218

  Fly   873 LQRFRPKVAVFNGKLIFEVFSGK------KEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAA 931
            ||:::|::||||||.|:|:||.:      |...||.||.::..|:|..:|||||||||||.|||.
Human   219 LQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQ 283

  Fly   932 DKVPFYAALKKFRDFLNGQIPHIDESECVFTDQRIRLCSAQQQVDIVGKINKTHQP--------P 988
            |||.:|..||..||.|.|...::|..|..:|   ..|..||:....:....:.:.|        .
Human   284 DKVHYYIKLKDLRDQLKGIERNMDVQEVQYT---FDLQLAQEDAKKMAVKEEKYDPGYEAAYGGA 345

  Fly   989 LGDHPSSLTVVSNCSGPIAGDAECGIVAEESDQVQSEK----------MIPQMDPTVPSSSN 1040
            .|::|        ||....|.:..|::  ||.:::.|.          |.......:||.||
Human   346 YGENP--------CSSEPCGFSSNGLI--ESVELRGESAFSGIPNGQWMTQSFTDQIPSFSN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 131/265 (49%)
TDGNP_003202.3 mug 2..329 CDD:273154 138/307 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..97 15/70 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158916
Domainoid 1 1.000 193 1.000 Domainoid score I3205
eggNOG 1 0.900 - - E1_COG3663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7652
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006159
OrthoInspector 1 1.000 - - oto89499
orthoMCL 1 0.900 - - OOG6_104831
Panther 1 1.100 - - LDO PTHR12159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1493
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.680

Return to query results.
Submit another query.