DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thd1 and tdg.2

DIOPT Version :9

Sequence 1:NP_001259060.1 Gene:Thd1 / 43796 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:XP_687336.3 Gene:tdg.2 / 558951 ZFINID:ZDB-GENE-131121-30 Length:400 Species:Danio rerio


Alignment Length:353 Identity:145/353 - (41%)
Similarity:191/353 - (54%) Gaps:70/353 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 KKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERKKHDRFNGMSEEEVIK 776
            |||||.:|             ..:::|..|          :::|| |.::..|||||||.|||:.
Zfish    90 KKRGRPRK-------------GEEREKTEA----------EESAK-KAKRTLDRFNGMSVEEVMA 130

  Fly   777 RTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQ-G 840
            |.:||.:..|||::|:||||||.:||||.||..|||||||||:|:|||.||::...|..|.:. |
Zfish   131 RKLPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYG 195

  Fly   841 IGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGK------KEFH 899
            |||||||.|.|.||.||:.|||:||...||||||.:||.:||||||.|:|:|..:      |...
Zfish   196 IGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLE 260

  Fly   900 FGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNG--QIPHIDESECVF- 961
            ||.||.:|..|:|..::|||||.||||.|||.|||.||..||:.||.|.|  :...|.|:...| 
Zfish   261 FGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLKGVTKTQEIQETNYSFD 325

  Fly   962 ----TDQRIRLCSAQQQVDIVGKINKTH------QPPLGDHPSSLTVVSNCSGPIAGDAECGIVA 1016
                .:...|:...::|.|...:....|      |...|.|||:.|                   
Zfish   326 LNLAKEDAKRMAIKEEQNDPGYEETCAHGSWGEPQQAFGVHPSTNT------------------- 371

  Fly  1017 EESDQVQSEK--MIP--QMDPTVPSSSN 1040
               |||..::  |.|  :..|.:..|:|
Zfish   372 ---DQVMDDRWTMQPFAEQIPDIRCSNN 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 125/261 (48%)
tdg.2XP_687336.3 UDG_like <83..338 CDD:294330 128/271 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594882
Domainoid 1 1.000 173 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006159
OrthoInspector 1 1.000 - - otm24883
orthoMCL 1 0.900 - - OOG6_104831
Panther 1 1.100 - - LDO PTHR12159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1493
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.