DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thd1 and thp1

DIOPT Version :9

Sequence 1:NP_001259060.1 Gene:Thd1 / 43796 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_588515.1 Gene:thp1 / 2539432 PomBaseID:SPCC965.05c Length:325 Species:Schizosaccharomyces pombe


Alignment Length:302 Identity:88/302 - (29%)
Similarity:148/302 - (49%) Gaps:54/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 SFMGEELHMHSPSHRHLDAVTTGPGRYGILVSNDT---PECLSREMYRHS-----QQSTTVLEQT 698
            ||..|.|.:......     |:|    |||....|   .|.|.|..:.|:     .:.|.|::.:
pombe    31 SFDDENLELEESREE-----TSG----GILKKAKTQSFSESLERFRFAHAGSNNEYRKTDVVKNS 86

  Fly   699 DSSSCGINFKPMPKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERKKH 763
            |:.: |:          .|..:..:..:.......|:..|.|..:|..:        |...:||:
pombe    87 DTDN-GL----------LKSAVETITLENGLRNRRVNVTKKSTLKASVK--------KSTLKKKN 132

  Fly   764 DRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQ--E 826
            :      .:..:.:.:||::|:|...:|||:|||:.::.|||.:|.|.|.|||.|..:.|.:  .
pombe   133 E------VDPALLQGVPDYICENPYAIIVGLNPGITSSLKGHAFASPSNRFWKMLNKSKLLEGNA 191

  Fly   827 QMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVF-NGKLIFE 890
            :.:...|..|...|:|.||:.||.:...|||.::|:::|:|||.||::|:||:|.:| :||.|:|
pombe   192 EFTYLNDKDLPAHGLGITNLCARPSSSGADLRKEEMQDGARILYEKVKRYRPQVGLFISGKGIWE 256

  Fly   891 ----VFSGK---KEFHFGRQPDRVDGTDTFIWVMPSSSARCA 925
                :.:||   |.|.||.||::....:.|:.:  |||.|.|
pombe   257 EMYKMLTGKKLPKTFVFGWQPEKFGDANVFVGI--SSSGRAA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 70/222 (32%)
thp1NP_588515.1 UDG_like 5..325 CDD:294330 88/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 107 1.000 Domainoid score I1658
eggNOG 1 0.900 - - E1_COG3663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006159
OrthoInspector 1 1.000 - - oto101021
orthoMCL 1 0.900 - - OOG6_104831
Panther 1 1.100 - - LDO PTHR12159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1493
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.