DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thd1 and Tdg

DIOPT Version :9

Sequence 1:NP_001259060.1 Gene:Thd1 / 43796 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_001375432.1 Gene:Tdg / 114521 RGDID:620959 Length:410 Species:Rattus norvegicus


Alignment Length:368 Identity:151/368 - (41%)
Similarity:204/368 - (55%) Gaps:55/368 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 PKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERK---------KHDRF 766
            ||:|.||.:       .::...||:.:|.:|.:    ..|....:|.|:.|         |.|||
  Rat    54 PKRRKRKTR-------AAEAQDPVEPKKPAASK----KSGKSTKSKEKQEKITDTFKVKRKVDRF 107

  Fly   767 NGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSAD 831
            ||:||.|::.:|:||.|..||||||:||||||.||||||||.||||||||||:::||::.|::..
  Rat   108 NGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHM 172

  Fly   832 EDHKLI-KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGK 895
            :||.|. |.||||||||.|.|.||.||:.||.:||.|||::|||:::|::||||||.|:|:||.:
  Rat   173 DDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKE 237

  Fly   896 ------KEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHI 954
                  |...||.||.::..|:|..:|||||||||||.|||.|||.:|..||..||.|.|.....
  Rat   238 VFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERST 302

  Fly   955 DESECVFTDQRIRLCSAQQQVDIVGKINKTHQP--------PLGDHPSSLTVVSNCSGPIAGDAE 1011
            |..|..:|   ..|..||:.........:.:.|        ..|::|        |:|...|.|.
  Rat   303 DVQEVQYT---FDLQLAQEDAKRTAVKEEKYDPGYEAAYGGACGENP--------CNGEPCGFAS 356

  Fly  1012 CGIVAEE---------SDQVQSEKMIPQMDPTVPSSSNATDGK 1045
            .|:.|..         ||....:.|.......:||.:|...|:
  Rat   357 NGLTANSAELGGESAPSDVPNGQWMAQSFAEQIPSFNNCGTGE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 129/263 (49%)
TdgNP_001375432.1 mug 2..325 CDD:273154 135/284 (48%)
motif A 134..138 CDD:381679 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352914
Domainoid 1 1.000 193 1.000 Domainoid score I3104
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006159
OrthoInspector 1 1.000 - - oto96623
orthoMCL 1 0.900 - - OOG6_104831
Panther 1 1.100 - - LDO PTHR12159
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.