DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and VRK2

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001123952.1 Gene:VRK2 / 7444 HGNCID:12719 Length:508 Species:Homo sapiens


Alignment Length:494 Identity:126/494 - (25%)
Similarity:209/494 - (42%) Gaps:114/494 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 RWKVVRKIGGGGFGEIYEGQDLITREQVA---LKVESARQPK--QVLKMEVAVLKKLQGKEHVCR 231
            :|.:.:|||.||||.||........|:.|   :|||......  ..||....|.||...|:.:.|
Human    28 QWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIER 92

  Fly   232 ----------FIGCG----RNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIE 282
                      |.|.|    :...:.::||:..|.:|.::  :...|.|..||.|:||:::|..:|
Human    93 KQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKI--SGQNGTFKKSTVLQLGIRMLDVLE 155

  Fly   283 SIHSVGFLHRDIKPSNFSVGRLPY-NCRRVYMLDFGLARQYTTGTGEVRCPRA---------AAG 337
            .||...::|.|||.:|..:|   | |..:||:.|:||:.:|        ||..         ..|
Human   156 YIHENEYVHGDIKAANLLLG---YKNPDQVYLADYGLSYRY--------CPNGNHKQYQENPRKG 209

  Fly   338 FRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPW-RKIKDKEQVGLTKEKYDHRI--- 398
            ..||:.:.|::||:...:.|..|:..|.|.::.::.|:||| :.:||...|...|......:   
Human   210 HNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQS 274

  Fly   399 LLKHLPS-----DLKQFLEHIQSLTYGDRPDYAML----------IGLFERCMKRRGVKESDPYD 448
            :||..||     ::.|||....||.|.::|:|..|          :|..:...|.:.:....| :
Human   275 VLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTP-N 338

  Fly   449 WEKVDS--TAIGNISATGNPSIPIKSDYMHGNITQMTVAA-------------SNASGTEYIRKR 498
            .:||||  .|...::...|..|..|   :|...:..:.|.             :|.:..|..|:|
Human   339 SQKVDSQKAATKQVNKAHNRLIEKK---VHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRR 400

  Fly   499 AEIETAHITATDPLNIKEKVDKNCNATSLAQPAKGSGEPMVQHGNAANNQNITSKGLQQQS---- 559
            .:.:.:.    :|||   :|:......|..|......||         :|:.||..:.::|    
Human   401 QKYQESQ----EPLN---EVNSFPQKISYTQFPNSFYEP---------HQDFTSPDIFKKSRSPS 449

  Fly   560 ----TLTNSQVAIANIQSA----PSMIEREDVQYTKLEE 590
                |.|.| ..|.:::|:    |::     .|:|..||
Human   450 WYKYTSTVS-TGITDLESSTGLWPTI-----SQFTLSEE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 88/308 (29%)
S_TKc 173..414 CDD:214567 81/278 (29%)
VRK2NP_001123952.1 STKc_VRK2 16..314 CDD:271025 87/298 (29%)
SPS1 29..421 CDD:223589 108/415 (26%)
Interaction with MAP3K7. /evidence=ECO:0000269|PubMed:17709393 397..508 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.