DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and Csnk1g1

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:XP_017451375.1 Gene:Csnk1g1 / 64086 RGDID:621404 Length:467 Species:Rattus norvegicus


Alignment Length:410 Identity:118/410 - (28%)
Similarity:196/410 - (47%) Gaps:24/410 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AKESVKMTSEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKM 215
            ::.|...||..:|..|    ..::|.:|||.|.|||:..|::|.|.|.||:|:|..:.....|.:
  Rat    26 SRPSGTSTSSGVLMVG----PNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHL 86

  Fly   216 EVAVLKKL----QGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQ 276
            |....|:|    :|...|..|..||   ::|.:|::|.|.:|.:|.....| .|:|.|.|.:.:|
  Rat    87 EYRFYKQLGSAGEGLPQVYYFGPCG---KYNAMVLELLGPSLEDLFDLCDR-TFTLKTVLMIAIQ 147

  Fly   277 ILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRV-YMLDFGLARQYTTGTGEVRCP-RAAAGFR 339
            :|..:|.:||...::||:||.||.:||.......| :::|||||::|.....:...| |......
  Rat   148 LLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLT 212

  Fly   340 GTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDK------EQVGLTKEKYDHRI 398
            ||.||.|||.|..:|..|.|||.:|.:|.:.|:.|.|||:.:|..      :::|.||.......
  Rat   213 GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRSTPIEA 277

  Fly   399 LLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDW-EKVDSTAIGNISA 462
            |.::.|.::..:|.:::.|.:.::|||..|..||....:|:|......||| .:...|.:|::..
  Rat   278 LCENFPEEMMTYLRYVRRLDFFEKPDYEYLRNLFTDLFERKGYTFDYAYDWVGRPIPTPVGSVHV 342

  Fly   463 TGNPSIPIKSDYMHGNITQMTVAASNASGTEYIRKRAEIETAHITATDPLNIKEKVDKNCNATSL 527
            ....|...:..:.|.:.........|.:.:...|...||:.:..|.|..|......|::..:..:
  Rat   343 DSGASAITRESHTHRDRPSQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQV 407

  Fly   528 AQPAKGS---GEPMVQHGNA 544
            .....|.   .:|...|.:|
  Rat   408 VSSTNGELNVDDPTGAHSSA 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 91/272 (33%)
S_TKc 173..414 CDD:214567 85/252 (34%)
Csnk1g1XP_017451375.1 STKc_CK1_gamma 43..331 CDD:271028 97/291 (33%)
CK1gamma_C 331..429 CDD:403712 16/97 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.