DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and vrk2

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_957464.2 Gene:vrk2 / 394145 ZFINID:ZDB-GENE-040426-1046 Length:574 Species:Danio rerio


Alignment Length:604 Identity:131/604 - (21%)
Similarity:221/604 - (36%) Gaps:191/604 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 KERWKVVRKIGGGGFGEIY-EGQD--LITREQV--ALKVE---------------SARQPKQVLK 214
            |:.|::.:.||.||||.|| ..||  :..|:..  .:|||               .|.:|:.:.|
Zfish    23 KKNWRIGKMIGKGGFGLIYLASQDVNVPVRDDADFVIKVEYHENGPLFSELKFYQRAAKPETMSK 87

  Fly   215 MEVAVLKKLQGKEHVCRFIGCGRND----RFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGL 275
            .   :..|..|...:..:.|.|..:    |:.::||...|.:|.:: .....|....::.|:||:
Zfish    88 W---MKSKQLGFLGIPTYWGSGLTESNGTRYRFMVMDRLGTDLQKV-LIDNGGQLRKTSVLQLGV 148

  Fly   276 QILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRA------ 334
            .:|..:|.||...::|.|||.:|..:|....|  :||:.|:||:.:|        ||..      
Zfish   149 LMLDVLEYIHDNEYVHADIKAANLLLGYRDPN--KVYLADYGLSYRY--------CPNGEHKEYK 203

  Fly   335 ---AAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPW-RKIKDKEQVGLTKEKYD 395
               ..|..||:.|.||:||:.....|..||..|.|.|:.:..|.||| ..:|:..:|...|.|  
Zfish   204 ENPKKGHNGTIEYTSIDAHKGVAASRRGDLKVLGYCLLHWQCGTLPWLPSLKNPAEVQEAKAK-- 266

  Fly   396 HRILLKHLPS------------DLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYD 448
               |:.:||.            ::.|||..::.|.|.::|||..|          |.|       
Zfish   267 ---LMSNLPDSVLKMSTSSSSMEIAQFLSRVKDLGYNEKPDYQAL----------RMV------- 311

  Fly   449 WEKVDSTAIGNISATGNPSIPIKSDYMHGNITQMTVAASNASGTEYIRKRAEIETAHITATDPLN 513
                       :||||               .|..:..|....:|.:|     .|....|:.|..
Zfish   312 -----------LSATG---------------LQGPLDLSRQRASETVR-----PTTQRAASQPKT 345

  Fly   514 IKEKVDKNCNATSLAQPAKGSGEPMVQHGNAANNQNITSKGLQQQSTLTNSQVAIANIQSAPSMI 578
            .::|:.:       ::||                  :|::.:.::      |:.:    |:|:.:
Zfish   346 TEKKMGR-------SKPA------------------VTAEEIDEE------QLGV----SSPNKV 375

  Fly   579 EREDVQYTKLEEGAPTKFITMKPNGECDNVDIAAKCIFEQKHV--EANDDIVGRASLSGVEQHYK 641
            .|:....|..:....|              |.|||....|..:  |:::|:...........|.:
Zfish   376 WRKTKPQTHKQRPVRT--------------DTAAKGSIRQNPMPCESDEDVSDEYEPLPPRVHPR 426

  Fly   642 SQIKKHNSPEIANKQIQRTGTVTNDKTSEVNRSTEEQKSTFGRLRVLTAPPMSVHDLPSGGGHSH 706
            ::.......|:  ||.::...|...||...||....|                         :.:
Zfish   427 TRAGTRQRQEL--KQEKKNEDVYEGKTWMTNRRQNHQ-------------------------YDN 464

  Fly   707 QVSDLSGKQDPYAATSNAA 725
            |.:......|.||..|:.|
Zfish   465 QQNSTRSIDDNYAVASSKA 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 84/306 (27%)
S_TKc 173..414 CDD:214567 78/286 (27%)
vrk2NP_957464.2 STKc_VRK2 13..313 CDD:271025 87/336 (26%)
SPS1 25..406 CDD:223589 112/496 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.