DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and Vrk2

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:XP_008768654.1 Gene:Vrk2 / 360991 RGDID:1311585 Length:503 Species:Rattus norvegicus


Alignment Length:485 Identity:114/485 - (23%)
Similarity:186/485 - (38%) Gaps:129/485 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KAKESVKMTSEDLLQPGHVVKE----RWKVVRKIGGGGFGEIYEGQDLITREQVA---LKVESAR 207
            :.||..|:...  |..|.::.:    :|.:.:.||.||||.||........|:.|   :|||  .
  Rat     4 RRKEKYKLPVP--LPEGKILDDMEGNQWALGKMIGSGGFGLIYLAFPTNKPEKDARHVIKVE--Y 64

  Fly   208 QPKQVLKMEVAVLKKLQGKEHVCR--------------FIGCGRND----RFNYVVMQLQGKNLA 254
            |....|..|:...::...:|.:.:              |.|.|..|    .:.::||:..|.:|.
  Rat    65 QENGPLFSELKFYQRAAKRECIQKWVKQRKLDYLGVPVFYGFGLTDFKGRSYRFMVMERLGIDLQ 129

  Fly   255 ELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLA 319
            :|  ....|||...|.|:||:::|..:|.||...::|.|||.:|..:|..  |..|||:.|:||:
  Rat   130 KL--LNQNGAFKKLTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYA--NPDRVYLADYGLS 190

  Fly   320 RQYTTGTGEVRCPRA---------AAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQ 375
            .:|        ||..         ..|..||:.:.|::||:.....|..|:..|.|.::.::.|:
  Rat   191 YRY--------CPNGNHKQYHEDPRKGHNGTLEFTSLDAHKGVAPSRRSDVEILGYCMLRWLCGK 247

  Fly   376 LPWR-KIKDKEQVGLTKEKYDHRILLKHLPS-------------DLKQFLEHIQSLTYGDRPDYA 426
            |||. .:::...|...|.|     ||..||.             :|.:|..::.:|.|..:|||.
  Rat   248 LPWETNLENPVAVQTAKTK-----LLDELPESVLKWTTSGSSCRELAEFFMYVHNLAYDAKPDYQ 307

  Fly   427 ML----------IGLFERCMKRRGVKESDPYDWEKVDSTAIGNISATGNPSIPIKSDYMHGNITQ 481
            .|          :|..:...|.:||....|.. .||||.     .|...|               
  Rat   308 KLKKILNPDGVPLGPLDFSTKAQGVNMQTPIH-RKVDSP-----KAIKKP--------------- 351

  Fly   482 MTVAASNASGTEYIRKRAEIETAHITATDPLNIKEKVDKNCNATSLA-QPAKGSGEPMVQHGNAA 545
                 :|...|:|.|                       |.|..|... :..:....|.|...:.|
  Rat   352 -----ANEFPTKYTR-----------------------KVCGETRATWREEQEERRPAVLLSDLA 388

  Fly   546 NNQNITSKGLQQQSTLTNSQVAIANIQSAP 575
            ..:|..::.:::.|...:..::....||.|
  Rat   389 TPENSRTRKVREYSDTFSEMLSFRQTQSYP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 84/314 (27%)
S_TKc 173..414 CDD:214567 77/284 (27%)
Vrk2XP_008768654.1 PKc_like 16..314 CDD:304357 84/316 (27%)
Pkinase 29..290 CDD:278497 76/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.