DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and CkIalpha

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:322 Identity:105/322 - (32%)
Similarity:163/322 - (50%) Gaps:36/322 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 QPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEH 228
            :|..:|..:::|:||||.|.||:||.|..:.:.|:||:|:|||......|..|..:.:.|.|...
  Fly    11 RPEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVG 75

  Fly   229 VCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRD 293
            ..|....|:...||.:||.|.|.:|.:|.....| .|::.|.|.|..|::..:|.||...|:|||
  Fly    76 FPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTR-HFTIKTVLMLVDQMIGRLEYIHLKCFIHRD 139

  Fly   294 IKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCP--------RAAAGFRGTVRYASINAH 350
            |||.||.:| :..:|.:::::|||||:::       |.|        |......||.||||||||
  Fly   140 IKPDNFLMG-IGRHCNKLFLIDFGLAKKF-------RDPHTRHHIVYREDKNLTGTARYASINAH 196

  Fly   351 RNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDH----------RILLKHLPS 405
            ...|..|.||:.||.|:::.|..|.|||:.:|    ....::||:.          .:|.|..|:
  Fly   197 LGIEQSRRDDMESLGYVMMYFNRGVLPWQGMK----ANTKQQKYEKISEKKMSTPIEVLCKGSPA 257

  Fly   406 DLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNISATGNPS 467
            :...:|.:.:||.:.::|||..|..||....:....:....|||     |.:...:..|.|:
  Fly   258 EFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDW-----TMLKQKTHQGQPN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 96/278 (35%)
S_TKc 173..414 CDD:214567 89/258 (34%)
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 95/277 (34%)
Pkinase_Tyr 23..284 CDD:285015 94/273 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452734
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.