DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and ZK354.6

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_500772.1 Gene:ZK354.6 / 191293 WormBaseID:WBGene00022707 Length:368 Species:Caenorhabditis elegans


Alignment Length:311 Identity:118/311 - (37%)
Similarity:183/311 - (58%) Gaps:14/311 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KAKESV------KMTSEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQ 208
            |.|:::      :|.:..|::.|.|:..|::|...||||||.:||:..|.:.:|..|:|||...|
 Worm    40 KEKQNIAGAVYNQMRNTILMEEGSVISGRFEVKGIIGGGGFAQIYKAWDKVRKEDCAIKVEHESQ 104

  Fly   209 PKQVLKMEVAVLKKLQGKEHVCRFIGCGR----NDRFNYVVMQLQGKNLAELRRAQPRGAFSLST 269
            ..:.:|:|:.||..|:|...:...:..|:    :::.:|:||||.|:||:::|||.|....:..|
 Worm   105 DIRRMKLEITVLLALRGSMGIPEILAQGKWQHEDNKSHYIVMQLVGRNLSDVRRALPHKRITERT 169

  Fly   270 TLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRA 334
            ..|..:|:|||:..:|..||||||:||||..:|.:  :|.|:|::|:||.|||....|.||.|||
 Worm   170 LYRAMIQVLKALSLVHGAGFLHRDLKPSNCCIGAI--DCTRIYLIDYGLTRQYLDKGGIVRKPRA 232

  Fly   335 AAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRIL 399
            ..|.||||||.|::||..:::|..:||.:..|..:|..:|.|||...|..|.:...|:.:....|
 Worm   233 GVGLRGTVRYMSLDAHARQDLGPKNDLVAFLYTTIECGDGYLPWSHEKTHENIIKLKQAHIGDKL 297

  Fly   400 LKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 450
            ....|. :.:..|:|:||.|...|||..|:.|.|.| ....:|||:||||:
 Worm   298 CTKQPV-MTKAAEYIESLNYHSIPDYEKLLALMEEC-NPPDLKESEPYDWQ 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 103/264 (39%)
S_TKc 173..414 CDD:214567 93/244 (38%)
ZK354.6NP_500772.1 PKc_like 68..330 CDD:389743 103/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.