DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and ZC373.3

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001257094.1 Gene:ZC373.3 / 191145 WormBaseID:WBGene00013868 Length:321 Species:Caenorhabditis elegans


Alignment Length:216 Identity:62/216 - (28%)
Similarity:103/216 - (47%) Gaps:10/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITRE-----QVALKVESARQPKQVL-KMEVAVL 220
            ||...:.:.:|:|::.|:|.|.|||:::..|.:...     ::..|......|:.:| ..|:...
 Worm    25 LLAKNNRIAKRYKLIHKVGSGSFGEVWQATDKLEGNVAKIVKIINKYVGGSGPRDILYDNEIEFF 89

  Fly   221 KKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIH 285
            |......::........:..||.:||..:|:||.|:.:..| |:|||:..:|:..||...:..||
 Worm    90 KYCHDAPNIPTLFHHFSHVGFNVLVMSEEGQNLREVAKRSP-GSFSLNNLIRIAYQIGSTLCFIH 153

  Fly   286 SVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGT-VRYASINA 349
            ...|:|||:|..|..|......|:.| ::|||.|.::....|. ..|....||..| ..:.|||.
 Worm   154 DKSFIHRDLKAENVLVSLKNKVCKMV-LIDFGNAVRFKDVNGN-ELPEFNDGFDYTHCTHKSINV 216

  Fly   350 HRNREMGRHDDLWSLFYMLVE 370
            .......::||..||.|:|:|
 Worm   217 LLGISHTQNDDWASLVYLLLE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 60/206 (29%)
S_TKc 173..414 CDD:214567 59/205 (29%)
ZC373.3NP_001257094.1 PKc_like 35..>236 CDD:389743 58/203 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.