DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and K08H2.5

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001361832.1 Gene:K08H2.5 / 187176 WormBaseID:WBGene00010692 Length:304 Species:Caenorhabditis elegans


Alignment Length:343 Identity:75/343 - (21%)
Similarity:147/343 - (42%) Gaps:82/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VKERWKVVRKIGGGGFGEIYEGQDLITREQ-VALKVESARQ--PKQVLKMEVAVLKKLQ--GKEH 228
            |...:|:|..:|.|.:|..:...|..:|.. :|||..:...  .:...|:|..||:::.  |...
 Worm     9 VLRNYKIVEVLGSGEYGTAFACVDADSRHSTLALKASNLETIFCENCFKLERTVLQRISTLGTNE 73

  Fly   229 VCRF------------IGCGRNDRFNYVVMQLQGKNLAEL-RRAQPRGAFSLSTTLRLGLQILKA 280
            ..||            :||        :||..:|.:|.:: :|..|: .||.:..|::.|.:.|:
 Worm    74 KSRFPTLVDNFVVDSTLGC--------LVMTKEGDSLGDVCKRNDPK-KFSPTNVLKIMLSVGKS 129

  Fly   281 IESIHSVGFLHRDIKPSN--FSVGRLPYN-CRRVYMLDFGLARQYTTGTGEV--RCPRAAAGFRG 340
            :::|||:|::||||..:|  |:....|.: |:   ::|:|:.:::....|..  ..|:....|: 
 Worm   130 LQTIHSLGYIHRDIHWNNVLFAKTITPASPCK---LIDYGVGKKFRNRRGNYVKNRPQRDVNFK- 190

  Fly   341 TVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPS 405
            ...:.|.|..........||..||.::.:: ::|      |...| :|...|....:::.:..||
 Worm   191 ECGHVSWNVMMGGVPNLKDDFSSLMFLGLK-ISG------ISSLE-IGSVSEVRHQKMIFELDPS 247

  Fly   406 DLKQFLEHIQSL---------TYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNIS 461
               :||..:..|         :..::.:||   |:|      ..:|:..|:|.|::         
 Worm   248 ---RFLRSVPWLLKVACVIVDSDAEKFNYA---GVF------NAIKQGFPFDEEEI--------- 291

  Fly   462 ATGNPSIPIKSDYMHGNI 479
                    |...|:.|::
 Worm   292 --------INHSYLQGSL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 66/292 (23%)
S_TKc 173..414 CDD:214567 62/263 (24%)
K08H2.5NP_001361832.1 PKc_like 12..>185 CDD:389743 46/184 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160928
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.