DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and F59E12.3

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_495099.2 Gene:F59E12.3 / 186628 WormBaseID:WBGene00019119 Length:141 Species:Caenorhabditis elegans


Alignment Length:116 Identity:33/116 - (28%)
Similarity:58/116 - (50%) Gaps:3/116 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 WKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGR 237
            :.:..||..|.||.|::..:..|..::.||.|....|...|::|:..:.:: .:.:|......|.
 Worm    22 YTINEKIAEGSFGAIFKVTEKSTGTRLVLKAELPGSPSNDLRIELVTMLRV-FRSYVPEVTDKGV 85

  Fly   238 NDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVG 288
            .:...:::|.|.||:|.::..|.|....||||.:....|.|:|||.  |:|
 Worm    86 FNGTKFLIMPLFGKSLEDIIGALPGNKCSLSTAIGSLYQCLEAIEL--SIG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 33/116 (28%)
S_TKc 173..414 CDD:214567 33/116 (28%)
F59E12.3NP_495099.2 PKc_like 21..>130 CDD:304357 29/108 (27%)
SPS1 22..>130 CDD:223589 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.