DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and F53C3.1

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_494695.2 Gene:F53C3.1 / 186157 WormBaseID:WBGene00018745 Length:328 Species:Caenorhabditis elegans


Alignment Length:315 Identity:115/315 - (36%)
Similarity:179/315 - (56%) Gaps:24/315 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DVKAKESVKMTSEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQ- 211
            |:..|...:::|.         |..:.|||.:|.||||.:|..:...|::|.|:|||.....:: 
 Worm     8 DINFKTGSEISSS---------KATYTVVRLLGEGGFGAVYLVEQAKTKKQFAMKVEKKMDTRKH 63

  Fly   212 -VLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNY--VVMQLQGKNLAELRRAQPRGAFSLSTTLRL 273
             .||||:|:||.:...:|..:....|:.|:..|  :||||.||:|:.|::.:|...|:..|.:.:
 Worm    64 SKLKMEIAILKLVGTCKHFTKIEDRGKKDKEGYFFIVMQLVGKSLSGLKKERPNQIFTFGTGMGV 128

  Fly   274 GLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRR--VYMLDFGLARQYTTGTGEVRCPRAAA 336
            |.|.|:|:|.:|..||:|||:||.|::.|:   :..|  :|:||||:||:|.....|::.||.:.
 Worm   129 GSQCLEAVEELHKQGFIHRDLKPQNYASGQ---DDERHLIYILDFGIARKYLNDKKEMKTPRESV 190

  Fly   337 GFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFV-NGQLPWRKIKDKEQVGLTKE--KYDHR- 397
            .|:||:|:|.::.||..|||..||..|.||:|::.: .|.||||..|.|.:|...||  :.|:| 
 Worm   191 AFKGTIRFAPLSCHRYTEMGPKDDCESWFYLLIDLILEGGLPWRHCKVKNEVLKIKENTRKDNRA 255

  Fly   398 ILLKHLP--SDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 450
            .|.|.:|  |:|.:.|::|.|..|.||.||..:...........|...:.|||||
 Worm   256 ALYKGIPQTSELNKILDYIDSRAYQDRIDYKFIYKALGEACSNAGCDINAPYDWE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 105/272 (39%)
S_TKc 173..414 CDD:214567 98/252 (39%)
F53C3.1NP_494695.2 PKc_like 23..292 CDD:389743 105/271 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.