DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and F39F10.2

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_510731.1 Gene:F39F10.2 / 185497 WormBaseID:WBGene00018202 Length:298 Species:Caenorhabditis elegans


Alignment Length:269 Identity:63/269 - (23%)
Similarity:116/269 - (43%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 IGGGGFGEIYEGQDLITREQVALKV---ESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDR 240
            :|.|.||.:...||..:.|...:|:   |......:..:.|...|..|.....|.:....|..:.
 Worm    16 LGRGSFGSVQLAQDKRSNEMRVMKLIRKERDGHRDETWRRETFTLTALSDVSGVTKMFEYGSTET 80

  Fly   241 FNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLP 305
            .|::||:....:|..:.|......||..|:.::..|::|.::.||::|.:|.|||..|..|. ..
 Worm    81 HNWIVMEQLSDDLITIVRRNETKMFSKPTSYQIMWQLVKILQDIHAIGIVHTDIKADNLMVS-YK 144

  Fly   306 YNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFR------GTVRYASINAHRNREMGRHDDLWSL 364
            ...|::.::|:||:..: ....:.|.|.|....|      ...:.|:.:.|...|     ||..:
 Worm   145 NRVRKLVLVDYGLSCWF-KDHNQNRTPPAPFDNRCMHLIHTPAKTATGHPHMEAE-----DLVQV 203

  Fly   365 FYM---LVEFVNGQLPWRKIKDKEQVGLTKE--KYDHRILLKHLPSDLKQFLEHIQSLTYGDRPD 424
            .|:   |.:|    :||:.::..:...:.|:  |...:.|..|  .|||..::.:....:|..||
 Worm   204 AYLSCSLHQF----MPWKDVEAPKMTKMKKKFAKNPKKYLGNH--QDLKPIIKMLVKQKHGVEPD 262

  Fly   425 YAMLIGLFE 433
            |..::.|.:
 Worm   263 YEGILDLLQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 63/267 (24%)
S_TKc 173..414 CDD:214567 58/248 (23%)
F39F10.2NP_510731.1 PKc_like 9..271 CDD:389743 63/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.