DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and F26A1.4

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_497995.2 Gene:F26A1.4 / 184945 WormBaseID:WBGene00017803 Length:206 Species:Caenorhabditis elegans


Alignment Length:214 Identity:76/214 - (35%)
Similarity:114/214 - (53%) Gaps:22/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 QILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRG 340
            |:|||:..:|...||||||||.|..:|..  :|.|:|::|:.|.|||....|.||.||...|.||
 Worm     3 QVLKALALVHRAEFLHRDIKPPNCCIGAT--DCTRIYLIDYVLTRQYLDKCGTVRNPRPGLGLRG 65

  Fly   341 TVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQ-VGLTKEKYDHRILLKHLP 404
            |:||.|::||..:::|..:||.|..|..:|..:|.|||...|.:|. :.|.:.....::.:|. |
 Worm    66 TMRYMSLDAHARQDLGPKNDLVSFLYTTIECGDGCLPWSYEKSEENCIKLKQAHIGEKLCIKK-P 129

  Fly   405 SDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNISATGNPSIP 469
            . :.:..|:|:||.|...|||..|:.|.|.| ....:|||:||:|:         .....||..|
 Worm   130 L-MTKAAEYIESLNYHSIPDYEKLLALIEEC-NPADLKESEPYEWQ---------YRQPHNPMTP 183

  Fly   470 IKSDYMHG-------NITQ 481
            ...:.::|       |:|:
 Worm   184 TTGEGLNGTPGGTKENVTE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 62/157 (39%)
S_TKc 173..414 CDD:214567 53/138 (38%)
F26A1.4NP_497995.2 PKc_like <3..157 CDD:389743 62/157 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.