DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and F22F1.2

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_509374.1 Gene:F22F1.2 / 184850 WormBaseID:WBGene00017714 Length:299 Species:Caenorhabditis elegans


Alignment Length:285 Identity:73/285 - (25%)
Similarity:114/285 - (40%) Gaps:41/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 RKIGGGGFGEIYEGQD----------LITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCR 231
            :|:|.|.:|::|..:|          ||.:|...::.|:.|:       |...|..|.....:.|
 Worm    15 KKLGEGSYGDVYFCRDERNNKWSVIKLIHKEINGVRDETWRR-------ETFALTALAEVRGISR 72

  Fly   232 FIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKP 296
            ....|..|..||:||:....:|..:.|......||.||...:..|::|.::.:||.|..|.|||.
 Worm    73 MYDYGATDIHNYIVMEPLLDDLTNIARRNGIKGFSKSTGFHILWQLVKILQDVHSFGIAHGDIKA 137

  Fly   297 SNFSVGRLPYNCRRVYML---DFGLARQYTTGTGE----VRCPRAAAGFRGT-VRYASINAHRNR 353
            .|..:.    ...:.:||   ||||:|.:....|.    :..|........| .|.|:...|...
 Worm   138 DNLMIS----GSNKTFMLSLVDFGLSRSFKDHNGNRTPPIPFPSGCINLIHTPARTANGKPHMEA 198

  Fly   354 EMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTK---EKYDHRILLKHLPSDLKQFLEHIQ 415
            |     ||..:.| |........||..|...:...|.|   || ..:.|.:|  .|||..::.|.
 Worm   199 E-----DLMQVAY-LACICRKLAPWEDIDGHKMTKLKKAFAEK-PKKFLGEH--QDLKPIIKIIA 254

  Fly   416 SLTYGDRPDYAMLIGLFERCMKRRG 440
            ...:|..|:|..::.|.:..:...|
 Worm   255 KQKHGKEPNYKEIMDLLQEMLTSSG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 72/276 (26%)
S_TKc 173..414 CDD:214567 67/257 (26%)
F22F1.2NP_509374.1 PKc_like 15..272 CDD:389743 72/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160961
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.