DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and F16B12.7

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_510350.2 Gene:F16B12.7 / 184566 WormBaseID:WBGene00008883 Length:301 Species:Caenorhabditis elegans


Alignment Length:311 Identity:72/311 - (23%)
Similarity:126/311 - (40%) Gaps:52/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDL--ITREQV--ALKVESARQPKQVLKMEVAVLK 221
            ||:  |.|||| :.|...||.|.:|.|....|:  :.:|:|  .:|.....|.::..|.|::|.:
 Worm     3 DLV--GKVVKE-YYVSYLIGEGSYGSIVAVNDMEELNKEKVIKLVKFVHGSQREKSFKTELSVFR 64

  Fly   222 KL--------QGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQIL 278
            ||        .|....|...   :.|.:..:|:..:|.||.::|:......|:......:|..:.
 Worm    65 KLDSLGNSKRNGFPQFCENF---QVDGYYAIVLSDEGDNLNDIRKRNKNLVFNRKNVATVGCAVS 126

  Fly   279 KAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVR 343
            :::.::||:||.|.|:...|..|.........:.::||||::::.|........:.........|
 Worm   127 RSLSTLHSIGFFHADLHEQNLMVPVPIDKINPIKLIDFGLSKRFKTRKRRNCIDKTYKVLLADER 191

  Fly   344 YASINAHRNREMGRHDDLWSLFYMLV--------------------------EFVNGQLPWRKIK 382
            ..|.|.....:..:.||..||||:|:                          |.....|||..|.
 Worm   192 RCSFNIACGGDYRKSDDFESLFYILLIDLGLSCYRENKAQRFLTKLKLHFATETFLQNLPWMTIV 256

  Fly   383 DKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFE 433
            .|.......:.::..|::|    .||:.:|.::..|.    ||.:..||.:
 Worm   257 FKSMRAQNDDDFNAEIMIK----ALKESVELLEEETL----DYTIDDGLIK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 65/298 (22%)
S_TKc 173..414 CDD:214567 60/278 (22%)
F16B12.7NP_510350.2 PKc_like 12..284 CDD:389743 60/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160925
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.