DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and C55B6.5

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_509211.2 Gene:C55B6.5 / 183840 WormBaseID:WBGene00016941 Length:102 Species:Caenorhabditis elegans


Alignment Length:117 Identity:24/117 - (20%)
Similarity:41/117 - (35%) Gaps:52/117 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGK 226
            ||....::.:::|:..|||.|..|::::..|.:  ::..||:             |.::.|..| 
 Worm     4 LLVKDRLLAKQYKLTTKIGAGDVGQVWQCTDRL--DENKLKI-------------VKIINKYVG- 52

  Fly   227 EHVCRFIGCGRND----------------RFNYVVMQLQGKNLAELRRAQPR 262
                   |.|..|                |||             |:|.|.|
 Worm    53 -------GVGPKDDSFANEVEFYKKCLTRRFN-------------LKRTQVR 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 22/107 (21%)
S_TKc 173..414 CDD:214567 22/106 (21%)
C55B6.5NP_509211.2 PKc_like 14..>71 CDD:304357 15/79 (19%)
SPS1 15..>71 CDD:223589 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.