DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and ttbk-6

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_498080.1 Gene:ttbk-6 / 183478 WormBaseID:WBGene00016673 Length:290 Species:Caenorhabditis elegans


Alignment Length:265 Identity:85/265 - (32%)
Similarity:134/265 - (50%) Gaps:13/265 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 MEVAVLKKLQGK---EHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQ--PRGAFSLSTTLRLG 274
            ||..|||||...   .|:......|:...|:|:||.|.|:||.:|....  ....||..|..|:|
 Worm     1 MEDHVLKKLNANGPAPHIPNLNLYGKKMNFSYMVMTLLGRNLQDLESTNFVVNKGFSRGTWSRVG 65

  Fly   275 LQILKAIESIHSVGFLHRDIKPSNFSVG--RLPYNCRRVYMLDFGLARQYTTGTGE-----VRCP 332
            :|.:.|::.:|..||:||::...|..:|  :.....:.:::|||||.|.:......     ||..
 Worm    66 IQWVYALKYVHYNGFIHRNVNTQNLFLGNEKDSERAKIIHILDFGLGRPFARYHARENKWIVRIA 130

  Fly   333 RAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQ-LPWRKIKDKEQVGLTKEKYDH 396
            |.:|.|||:.||||.|.|..:|.||.||:|||.|:::|...|: |||:....:.:|...|.....
 Worm   131 RHSAEFRGSFRYASPNVHLRKEQGRVDDVWSLPYVIIELNGGKALPWQTDYRRGRVEQMKLNLTP 195

  Fly   397 RILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNIS 461
            :.::..:|:.:.:.:.|:.||.|..|||..|:...|.:.|:...:..|..:|||..:.......:
 Worm   196 KDVMSDMPACMDKLMPHLASLNYYQRPDDHMIFKCFWQVMENEKITPSSKFDWENEEPDMSVPPA 260

  Fly   462 ATGNP 466
            |..||
 Worm   261 AWENP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 76/230 (33%)
S_TKc 173..414 CDD:214567 68/211 (32%)
ttbk-6NP_498080.1 PKc_like 1..231 CDD:304357 76/229 (33%)
SPS1 2..287 CDD:223589 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.