DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and C44C10.7

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_509953.1 Gene:C44C10.7 / 183456 WormBaseID:WBGene00008088 Length:341 Species:Caenorhabditis elegans


Alignment Length:227 Identity:59/227 - (25%)
Similarity:102/227 - (44%) Gaps:15/227 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 ESVKMTSEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITR-EQVALKVE--SARQPKQVLK 214
            :|.|||...:   |..|: .::::..:|||.||.:|...|:..| .|:|:|..  |....:...|
 Worm    35 QSSKMTFPIV---GDNVR-NYEIISVLGGGAFGTVYSCVDVDDRLNQLAIKAMDLSTVTRENSYK 95

  Fly   215 MEVAVLKKLQGKEHV-----CRFIGCGRND-RFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRL 273
            :|:.||::::....|     .:.||....| ...:.||..:|:.:.|:......|.||.|..|::
 Worm    96 LELMVLQRVETLSEVEQTRFSKLIGNFIQDSSLGFFVMHKEGECVDEVWMRNKSGRFSASNVLKI 160

  Fly   274 GLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGE-VRCPRAAAG 337
            ...:...:.|:|.:||:|||....|............|.::|||:.|::....|. :..|.....
 Worm   161 VHCMAHGLRSLHKIGFIHRDCHAGNILFASRLTPTAPVKIVDFGIGRRFANRRGHPIPSPSRDID 225

  Fly   338 FRGTVRYASINAHRNREMGRHDDLWSLFYMLV 369
            |.| ..:.|:|.|.....|..||..|:..:.:
 Worm   226 FLG-CEHCSVNVHVGGIPGPKDDFLSMVLLAI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 53/208 (25%)
S_TKc 173..414 CDD:214567 53/207 (26%)
C44C10.7NP_509953.1 PKc_like 50..>250 CDD:389743 52/200 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.