DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and C25H3.1

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001379695.1 Gene:C25H3.1 / 182922 WormBaseID:WBGene00016111 Length:211 Species:Caenorhabditis elegans


Alignment Length:220 Identity:67/220 - (30%)
Similarity:118/220 - (53%) Gaps:12/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 VDVKAKESVKMTSEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQ 211
            :|.:.|.|:.:        |..|..::||.:.:|||.:|.::|..:|.|.::.|:|.|.:...|.
 Worm     1 MDSENKTSIAI--------GCKVCNKYKVTKLLGGGSYGCVHEVIELKTGDRYAMKSEYSSMKKP 57

  Fly   212 VLKMEVAVLKKLQ--GKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLG 274
            :|..|:.|:|.:.  ..:||.:....|.:....:::||:..||:.|:.... .|:.:|:|.:...
 Worm    58 ILLNELKVMKAIYTFSSQHVLKVRDMGVHGSTKFIIMQMLEKNMDEVFELL-GGSMTLNTAVATS 121

  Fly   275 LQILKAIESIHSVGFLHRDIKPSNFSV-GRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGF 338
            .|.|:.:|.:|..|||||||||:|:.: .......|.:|::|:|:.:::......:|.||....|
 Worm   122 YQCLEGLEFMHWAGFLHRDIKPNNYCLDANSGQGLRTIYIIDYGICKRFVDNNNVIRQPRKITKF 186

  Fly   339 RGTVRYASINAHRNREMGRHDDLWS 363
            |||:.:|.|.:|..||..|..||.|
 Worm   187 RGTLDFAPIVSHELREHSRGSDLES 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 62/195 (32%)
S_TKc 173..414 CDD:214567 62/194 (32%)
C25H3.1NP_001379695.1 PKc_like 18..>211 CDD:419665 61/193 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.