DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and tag-191

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_506600.1 Gene:tag-191 / 179960 WormBaseID:WBGene00007049 Length:346 Species:Caenorhabditis elegans


Alignment Length:319 Identity:123/319 - (38%)
Similarity:185/319 - (57%) Gaps:17/319 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITR-EQVALKVE--SARQPKQVLKMEVAVLK 221
            ::.|:.|.||.::::|::::|.||.|.:|:.:|:..: :|.|:|||  |......||||||.:|.
 Worm     7 DETLKIGVVVGKKYRVIQQLGQGGCGSVYKVEDIEDKTKQYAMKVEFNSNANAGNVLKMEVQILT 71

  Fly   222 KLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAEL-RRAQPRGAFSLSTTLRLGLQILKAIESIH 285
            .|..|.||.:.:..|:.||::||||.|.|::|..| ::..|  .|::||.:|:|:.:|..|:.||
 Worm    72 HLVSKNHVAKCMASGKKDRYSYVVMTLLGESLESLMKKHGP--FFNVSTQMRIGICLLFGIKQIH 134

  Fly   286 SVGFLHRDIKPSNFSVGRLPYNCRRVY-MLDFGLARQYTTGTGE---VRCPRAAAGFRGTVRYAS 346
            .:||:|||:||:|.::|.......|.: :|||||||||.|...:   :|.||..|.||||.||.|
 Worm   135 DIGFIHRDLKPANVALGNKGSPDERYFIVLDFGLARQYITDKEDGKKMRRPREKALFRGTSRYCS 199

  Fly   347 INAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFL 411
            :..|...|.||.||||:|.|||.| :..||.|..:.||.::|..|.....:.|....|..:.:|:
 Worm   200 VAMHDRFEQGRVDDLWALIYMLAE-LRCQLAWSDLDDKVEIGEMKRHVADQNLFAKSPIQMLEFV 263

  Fly   412 EHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE------KVDSTAIGNISATG 464
            :.:::..:..||||..|..|....||....|.||||.||      |....|:||:...|
 Worm   264 KIVRATQFYHRPDYEKLFNLLNDAMKSAKYKWSDPYHWEPEKRKKKPSVPAVGNVPRKG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 105/268 (39%)
S_TKc 173..414 CDD:214567 99/248 (40%)
tag-191NP_506600.1 STKc_TTBK 19..285 CDD:270919 105/268 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160938
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101431
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.