DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and Y38H8A.3

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_502596.1 Gene:Y38H8A.3 / 178315 WormBaseID:WBGene00012637 Length:308 Species:Caenorhabditis elegans


Alignment Length:294 Identity:123/294 - (41%)
Similarity:178/294 - (60%) Gaps:9/294 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKL--QG 225
            |.||..| |||.:.:|:|.||||.:|...|  ...:.|:|||.|.:..||||:||:||.||  :|
 Worm     8 LNPGQQV-ERWSIEKKLGEGGFGAVYRVFD--ATGKYAMKVEGANEQIQVLKLEVSVLNKLSKRG 69

  Fly   226 KEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFL 290
            ..|.|:....||...||||||.|.||:|.:|.:|...|..|:..::.:|:|.|:|:|.:|::|:|
 Worm    70 NRHFCKIEDKGRFGNFNYVVMTLVGKSLQDLNKAGVGGHMSMGCSIGIGIQSLEALEDLHNIGYL 134

  Fly   291 HRDIKPSNFSVGRLPYN-CRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNRE 354
            |||:||.|:::||...| .|:||:||||:.|::|...|.:|.||.||||||||:||.|:.|..||
 Worm   135 HRDVKPGNYTIGRPELNEIRKVYILDFGMCRKFTGNDGTIRKPRQAAGFRGTVKYAPISCHLQRE 199

  Fly   355 MGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHR---ILLKHLPSDLKQFLEHIQS 416
            :.|.|||.:..||.||..:|.:||:.|.|..|||..|:...:.   :.....|...:..:..:.:
 Worm   200 LCRKDDLETWMYMQVELSHGTIPWQYISDMNQVGQAKQAIRNNLGSLFPPPCPHQFQDIMRMVDA 264

  Fly   417 LTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 450
            :.|.|.|:|..:.|:..:.....|..|:.|||||
 Worm   265 MKYYDAPNYQAIYGMMRQAYGACGSNENAPYDWE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 111/266 (42%)
S_TKc 173..414 CDD:214567 105/246 (43%)
Y38H8A.3NP_502596.1 STKc_TTBK 16..281 CDD:270919 111/266 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160947
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101431
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3595
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.