DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and C49C8.1

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_501483.2 Gene:C49C8.1 / 177670 WormBaseID:WBGene00016765 Length:502 Species:Caenorhabditis elegans


Alignment Length:412 Identity:115/412 - (27%)
Similarity:179/412 - (43%) Gaps:119/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KAKESVKMTSED--LLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQ---VALKVESARQ- 208
            ::|||.....:|  :...|..:.: :::|.||..||||::::    :|::.   .|:|:||..| 
 Worm     3 QSKESPDEAKQDEIIFNIGDTIND-YEIVSKIDEGGFGQVFK----VTKDHKTFYAMKLESNFQV 62

  Fly   209 PKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPR-GAFSLSTTLR 272
            ....:|:|:.||.:|.........|..|:..|::::|::|.|.||..|:...|. ..||..|..|
 Worm    63 GGSAIKLEINVLSQLPKNTVFPELICGGKRPRYHFLVLELLGDNLKALKAQSPNPSVFSDGTWSR 127

  Fly   273 LGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYN------CRRVYMLDFGLARQY--------- 322
            :|:|.|.|::.:|..||:|||||||||::|   |:      .|||.:.||||||::         
 Worm   128 IGIQCLYAMKMMHDSGFVHRDIKPSNFAIG---YSTASESRSRRVLLFDFGLARKFVKKEKNLAP 189

  Fly   323 ------------------------------------------------------------TTGTG 327
                                                                        :..|.
 Worm   190 IVTKKESKISKSKTLPSKGPSTKSKDLKPGRSKPILNRKAEQMKIKKNFNMLIPPKSIDQSQRTA 254

  Fly   328 E---------VRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKD 383
            |         .|..|....||||.:|||.|||...|:|||||:|||.||:.||. .:|||   ..
 Worm   255 EEKVDDEEFTFRRARPHTDFRGTFQYASPNAHLQLELGRHDDIWSLMYMVAEFF-VELPW---TS 315

  Fly   384 KEQVGLTKEKYDHRILLKHLPSD--------------LKQFLEHIQSLTYGDRPDYAMLIGLFER 434
            .|::.|.:.|....||  .|.||              |.:..::::|..|...|.|.::...|:.
 Worm   316 NEEIALEELKNQSSIL--RLFSDDKNPSRLTPEMRGQLDEIDKNLKSCNYYSSPKYDIVYQFFKD 378

  Fly   435 CMKRRGVKESDPYDWEKVDSTA 456
            .|.:..|..:.|||||.:..::
 Worm   379 SMTKAKVTWTTPYDWETIGKSS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 102/363 (28%)
S_TKc 173..414 CDD:214567 98/343 (29%)
C49C8.1NP_501483.2 PKc_like 27..377 CDD:389743 102/362 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.