DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and Y39G8C.2

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_496946.1 Gene:Y39G8C.2 / 175061 WormBaseID:WBGene00012731 Length:276 Species:Caenorhabditis elegans


Alignment Length:280 Identity:104/280 - (37%)
Similarity:161/280 - (57%) Gaps:22/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DVKAKESVKMTSEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQ- 211
            ||..|..|:::|.         |..:.|.|.:|.||||.:|..:|..|.:..|:|||...:.:: 
 Worm     8 DVNFKPGVEISSG---------KANYVVSRLLGEGGFGAVYLVKDTKTNKTFAMKVEQKMEKRKH 63

  Fly   212 -VLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNY--VVMQLQGKNLAELRRAQPRGAFSLSTTLRL 273
             .||||:|:||.:...:|..:.:..|:.|:..|  :||:|.||:|.:|:..:....||..|.|.:
 Worm    64 SKLKMEIAILKLVGAGKHFTQIVDRGKKDKEGYFFLVMELVGKSLGDLKNERAERVFSFGTGLGV 128

  Fly   274 GLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGF 338
            ..|.|:|:|.:|..||:|||:||.|::.| |......:|:||||:||:|.....|::.||.|.||
 Worm   129 ASQCLEAVEDLHRTGFIHRDLKPQNYACG-LDEKRHNIYILDFGIARKYLNTKNELKTPREAVGF 192

  Fly   339 RGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQ-LPWRKIKD-----KEQVGLTKEKYDHR 397
            :||||:|.:..||..|:|..||..|.||:|::.:..: |||||:.:     ||:....|||.|..
 Worm   193 KGTVRFAPLACHRFTELGPRDDCESWFYLLLDLILPRGLPWRKMNEKGEVLKEKEECRKEKRDKL 257

  Fly   398 IL-LKHLPSDLKQFLEHIQS 416
            .. :|| .|:|.:.|::|.|
 Worm   258 FYGIKH-ASELNKILDYIDS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 98/256 (38%)
S_TKc 173..414 CDD:214567 96/251 (38%)
Y39G8C.2NP_496946.1 PKc_like 23..276 CDD:389743 97/254 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.