DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and csnk-1

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_492694.1 Gene:csnk-1 / 172891 WormBaseID:WBGene00013709 Length:407 Species:Caenorhabditis elegans


Alignment Length:415 Identity:122/415 - (29%)
Similarity:195/415 - (46%) Gaps:40/415 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LVDVKAKESVKMTSEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPK 210
            :.:.:...|....|....|...:|...:||.:|||.|.|||:..|::|...|.||:|:|..:...
 Worm     1 MTNTRGSNSATSASTTNSQGVLMVGPNFKVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSKA 65

  Fly   211 QVLKMEVAVLKKL---QGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLR 272
            ..|.:|....|.|   :|...|..|..||   ::|.:||:|.|.:|.:|.....| .|||.|...
 Worm    66 PQLHLEYRFYKLLGQAEGLPQVHYFGPCG---KYNALVMELLGHSLEDLFDLCDR-HFSLKTVAM 126

  Fly   273 LGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRR---VYMLDFGLARQY-TTGTGEVRCPR 333
            :.:|:::.||.:|:...::||:||.||.:||  |:.|:   ::::|||||::| ...||:....|
 Worm   127 VAMQLIRRIEYVHTKHLIYRDVKPENFLIGR--YSTRKQHVLHIIDFGLAKEYIDCDTGKHIAYR 189

  Fly   334 AAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDK------EQVGLTKE 392
            ......||.||.|||.|..:|..|.|||.:|.:|.:.|:.|.|||:.:|..      :::|.||.
 Worm   190 EHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKR 254

  Fly   393 KYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDW-EKVD--S 454
            :....:|.:..|.:..|:|.:.:.|.:.:.|||.....||:..:.|.|......:|| .|::  |
 Worm   255 QTAVEVLCEGFPDEFAQYLRYARRLDFFETPDYDFCYNLFKSVLDRLGATYDYEFDWTPKLNNVS 319

  Fly   455 TAIG--------NISATGNPSIPIKSDYMHGNITQMTVAASNASGTEYIRKRAEIETAHITATDP 511
            |..|        ::..|....:.:.....|.......|..|||.......:..|..||   |.|.
 Worm   320 TPSGSLHTSESKDVKRTDRGELKVSQAAAHAQFGSTQVINSNAGEVVEESRNTEGRTA---AGDN 381

  Fly   512 LN-------IKEKVDKNCNATSLAQ 529
            .:       .:.:..|:.|||...|
 Worm   382 SSGEVKCCCFRRRRRKHNNATPATQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 93/273 (34%)
S_TKc 173..414 CDD:214567 88/253 (35%)
csnk-1NP_492694.1 STKc_CK1_gamma 27..314 CDD:271028 98/292 (34%)
SPS1 27..>249 CDD:223589 81/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.