DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and Y65B4A.9

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001293249.1 Gene:Y65B4A.9 / 171658 WormBaseID:WBGene00022032 Length:391 Species:Caenorhabditis elegans


Alignment Length:339 Identity:100/339 - (29%)
Similarity:155/339 - (45%) Gaps:69/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 MTSEDLLQPGHVVKE-------RWKVVRKIGGGGFGEIYEGQDLITREQ----VALKVESARQPK 210
            |||   :.||...||       .::|.:.:..|.||.||:    :.||.    .|:|.|:.....
 Worm     1 MTS---VGPGQPQKELIRAQNGTYEVTKPLATGTFGSIYK----VKRESDGKFFAVKCEALNMKS 58

  Fly   211 QVLKMEVAVLKKLQGKEHVCRFI------GCGRNDRFNYVVMQLQGKNLAEL-RRAQPRGAFSLS 268
            .:|:....||..:   .|...|.      |...| ||.::||.|.|:||.|| ........||::
 Worm    59 SLLRQMSVVLASI---HHPSPFFTNIEERGTVPN-RFLFIVMPLYGENLYELMMNTNKDRKFSMA 119

  Fly   269 TTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGR-LPYNCRRVYMLDFGLARQ----YTTGTGE 328
            |.|.|..|.|.||..:|..||:|||||||:|.:|| :.....:||:|||||.::    ......|
 Worm   120 TGLHLAEQTLAAIRDLHRNGFIHRDIKPSHFCIGREIDGQHHQVYLLDFGLCKRPRFVKKNDEAE 184

  Fly   329 VRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKI-KDKEQVGL--- 389
            .:..:.|..:||.|:|||::||:.:.:|..||:.|.:||::||..|.|||..: |:.||..|   
 Worm   185 EQMRKNAIHYRGVVKYASVHAHQGKNLGYKDDMESWWYMVLEFFLGALPWALLNKESEQDVLHLK 249

  Fly   390 ------------------TKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCM 436
                              |...:|...:::. |.|:.:|:|            |..:....::..
 Worm   250 RRITAPMVASVWRTTPETTAGFFDLLTIIRE-PKDVAEFVE------------YDRIADGIQKLF 301

  Fly   437 KRRGVKESDPYDWE 450
            ::......:|.||:
 Worm   302 EKSKSNTQEPPDWD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 90/298 (30%)
S_TKc 173..414 CDD:214567 89/278 (32%)
Y65B4A.9NP_001293249.1 STKc_TTBK 20..302 CDD:270919 90/302 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.