DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and CSNK1D

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:XP_005256393.1 Gene:CSNK1D / 1453 HGNCID:2452 Length:450 Species:Homo sapiens


Alignment Length:453 Identity:138/453 - (30%)
Similarity:198/453 - (43%) Gaps:81/453 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFI 233
            |..|:::.||||.|.||:||.|.|:...|:||:|:|..:.....|.:|..:.|.:||...:....
Human     5 VGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIR 69

  Fly   234 GCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSN 298
            .||....:|.:||:|.|.:|.:|.....| .|||.|.|.|..|::..||.|||..|:|||:||.|
Human    70 WCGAEGDYNVMVMELLGPSLEDLFNFCSR-KFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDN 133

  Fly   299 FSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCP-RAAAGFRGTVRYASINAHRNREMGRHDDLW 362
            |.:| |......||::|||||::|.........| |......||.||||||.|...|..|.|||.
Human   134 FLMG-LGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE 197

  Fly   363 SLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDH----------RILLKHLPSDLKQFLEHIQSL 417
            ||.|:|:.|..|.|||:.:|    ....::||:.          .:|.|..||:...:|...:||
Human   198 SLGYVLMYFNLGSLPWQGLK----AATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSL 258

  Fly   418 TYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNISATGNPSIPIKSDYMHGNITQM 482
            .:.|:|||:.|..||.....|:|......:||..:...|                          
Human   259 RFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGA-------------------------- 297

  Fly   483 TVAASNASGTEYIRKRAEIETAHITATDPLNIKEKVDKNCNATSLAQPAKGSGEPMVQHGNAANN 547
            :.||.:|.     |:|.:.|             |::..:.|..:...|:..||.           
Human   298 SRAADDAE-----RERRDRE-------------ERLRHSRNPATRGLPSTASGR----------- 333

  Fly   548 QNITSKGLQQ---QSTLTNSQVAIANIQSAP-SMIEREDVQYTKLEEGAPTKFITMKPNGECD 606
                .:|.|:   .:.||.:. ..||....| |.:|||.....:|..|||....:....|..|
Human   334 ----LRGTQEVAPPTPLTPTS-HTANTSPRPVSGMERERKVSMRLHRGAPVNISSSDLTGRQD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 103/271 (38%)
S_TKc 173..414 CDD:214567 94/251 (37%)
CSNK1DXP_005256393.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 105/279 (38%)
TyrKc 10..273 CDD:197581 101/268 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.