DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and AgaP_AGAP008476

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:XP_316966.4 Gene:AgaP_AGAP008476 / 1277500 VectorBaseID:AGAP008476 Length:317 Species:Anopheles gambiae


Alignment Length:332 Identity:87/332 - (26%)
Similarity:137/332 - (41%) Gaps:71/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFI 233
            |..::::.||||.|.||:||.|.::.|.|:||:|:|..:.....|.:|....|.|||...:....
Mosquito     6 VGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTKHPQLHIESKFYKMLQGAVGIPTIK 70

  Fly   234 GCGRNDRFNYVVMQLQGKNLAEL--RRAQPRGAFSLSTTLRLGLQ-ILKAIESIHSV---GFLHR 292
            .||....:|.:||:|.|.:|.:|  :..||       .::|:..| ::..:..:.||   .|.|.
Mosquito    71 WCGSEGDYNVMVMELLGPSLEDLIDKICQP-------ASVRVACQAVVWCVGPVTSVVFYVFFHT 128

  Fly   293 DIKP-----------SNFSVG----RLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTV 342
            ...|           |..|.|    ::...|.||.:..|....:..|.......||:..      
Mosquito   129 KKGPVAAWHGARGTSSRASAGDLLRKVTVLCVRVCVCVFAGRSKTKTNLHPPHTPRSVC------ 187

  Fly   343 RYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRI--------- 398
                        ..|.|||.||.|:|:.|..|.|||:.:|...:    ::||: ||         
Mosquito   188 ------------QSRRDDLESLGYVLMYFNLGTLPWQGLKAANK----RQKYE-RISEKKLSTPV 235

  Fly   399 --LLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNIS 461
              |.|..|.:...:|.:.:.:.:..||||..|..||.....|:|......:||         |:.
Mosquito   236 EELCKGYPREFSLYLAYCRHMDFIQRPDYCYLRKLFRTLFHRQGFVYDYVFDW---------NML 291

  Fly   462 ATGNPSI 468
            ..|.|::
Mosquito   292 KFGRPNL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 78/292 (27%)
S_TKc 173..414 CDD:214567 72/272 (26%)
AgaP_AGAP008476XP_316966.4 PKc_like 9..280 CDD:304357 80/300 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.