DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and AgaP_AGAP004901

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:XP_314990.4 Gene:AgaP_AGAP004901 / 1275706 VectorBaseID:AGAP004901 Length:207 Species:Anopheles gambiae


Alignment Length:312 Identity:57/312 - (18%)
Similarity:103/312 - (33%) Gaps:126/312 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 HVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESAR--QPKQVLKMEVAVLKKLQGKEHV 229
            :::..:::.:||||.|.|..:|.|:|:....:||:|::..|  :.:.:|..|..|..:|.|.|.:
Mosquito     2 NLICNKYRRIRKIGMGTFCNVYLGEDIENGLKVAIKMDKCREEESRSLLPHEYKVYAQLAGCEGI 66

  Fly   230 CRFIGCGRNDRFNYVVMQLQGKNLAEL-----RRAQPRGAFSLSTTLRLGLQILKAIESIHSVGF 289
            ......|:...:|.:||...|.:|.:|     ||      |||.|.:.|..|::           
Mosquito    67 PVVHLFGQERGYNVIVMDKLGPSLEDLFNFCSRR------FSLKTVMMLVDQMI----------- 114

  Fly   290 LHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNRE 354
                                                                       ..||  
Mosquito   115 -----------------------------------------------------------TKRN-- 118

  Fly   355 MGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTY 419
                                    .:|.:|:.....::      |...||.:...:|::.:|:::
Mosquito   119 ------------------------ERIMEKKLATSIED------LCAGLPEEFGSYLQYCRSMSF 153

  Fly   420 GDRPDYAMLIGLFERCMKRRGVKESDPYDWE--------KVDSTAIGNISAT 463
            .::|||...|..|...:....:|....:||.        :.||   .|.|||
Mosquito   154 DEQPDYQYWISTFREVLSANELKYDLIFDWHGLMPSEAAEQDS---NNASAT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 47/267 (18%)
S_TKc 173..414 CDD:214567 42/247 (17%)
AgaP_AGAP004901XP_314990.4 PKc_like 7..166 CDD:304357 47/266 (18%)
SPS1 7..>114 CDD:223589 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.