DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and CSNK1A1L

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_660204.2 Gene:CSNK1A1L / 122011 HGNCID:20289 Length:337 Species:Homo sapiens


Alignment Length:365 Identity:109/365 - (29%)
Similarity:168/365 - (46%) Gaps:56/365 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRF 232
            ||..::|:|||||.|.||::|.|......|.||:|:||.:.....|..|..:...|||...:...
Human    12 VVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHM 76

  Fly   233 IGCGRNDRFNYVVMQLQGKNLAEL-----RRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHR 292
            ...|:....|.:||.|.|.:|.:|     ||      |::.|.|.|..|::..||.:|:..||||
Human    77 HWYGQEKDNNVLVMDLLGPSLEDLFNFCSRR------FTMKTVLMLADQMISRIEYVHTKNFLHR 135

  Fly   293 DIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCP-RAAAGFRGTVRYASINAHRNREMG 356
            ||||.||.:| ...:|.:::::|||||::|.........| |......|||||||||||...|..
Human   136 DIKPDNFLMG-TGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQS 199

  Fly   357 RHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDH----------RILLKHLPSDLKQFL 411
            |.||:.||.|:.:.|....|||:.::...:    |:||:.          .:|.|..|::...:|
Human   200 RRDDMESLGYVFMYFNRTSLPWQGLRAMTK----KQKYEKISEKKMSTPVEVLCKGFPAEFAMYL 260

  Fly   412 EHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNISATGNPSIPIKSDYMH 476
            .:.:.|.:.:.|||..|..||....:....:....:||..:...|                    
Human   261 NYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKA-------------------- 305

  Fly   477 GNITQMTVAASNASGTEYIRKRAEIETAHITATDPLNIKE 516
                ....|:|:..|     ::|:.:|...|..:..|:|:
Human   306 ----AQQAASSSGQG-----QQAQTQTGKQTEKNKNNVKD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 95/276 (34%)
S_TKc 173..414 CDD:214567 89/256 (35%)
CSNK1A1LNP_660204.2 STKc_CK1_alpha 16..281 CDD:271030 94/275 (34%)
SPS1 16..>239 CDD:223589 85/233 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..337 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.